Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - large image1
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - image1
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - image2
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - image3
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - image4
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - image5
LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China buy - image6

LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China

1 Inquiries

Unit Price:

$76-79/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hongkong

Brand:

Fire

Packaging:

10vials/box

Price valid (until):

2026-10-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,Skincare

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description

    We firmly believe this freeze-dried powder delivers outstanding quality, performance, and value. If you have any questions or are interested in how it can support your business growth, please don’t hesitate to reach out to us. We are dedicated to providing excellent service to help you achieve your goals.
    Key Advantages:

    Storage at Ultra-Low Temperatures: Maintained at -196°C, the active ingredients are kept in a dormant state, ensuring maximum preservation of their potency.
    Easy Activation: Simply add a suitable solvent and mix well to effectively reactivate the product, restoring its high activity and stability.

    Our product range includes diverse, premium peptides offered at competitive prices. Customer feedback has been consistently positive, reflecting our commitment to quality and reliability.

    Items Specifications
    CAS NO 154947-66-7
    Name LL-37
    Purity 99%

    Overview:  

    We specialize in high-purity peptide products, with each batch produced on dedicated production lines to ensure purity levels exceeding 99%. Our commitment to quality and innovation makes us a trusted partner in the global research, pharmaceutical, and healthcare industries.

     

    Quality Assurance:  

    All our products undergo rigorous testing and quality control under strict management systems. We provide comprehensive documentation including Certificates of Analysis to verify purity, potency, and compliance with international standards, ensuring reliability and transparency for our clients.

     

    Global Reach and Service:  

    With extensive experience and a wide-reaching logistics network, we offer door-to-door delivery and customs clearance assistance for clients worldwide, including the USA, Canada, Australia, Europe, and many other regions. Our dedicated customer service team is committed to providing prompt, responsive support.

     

    Core Values:  

    - Integrity: We operate honestly and transparently, earning the trust of customers, partners, and society.  

    - Quality First: We prioritize safety, effectiveness, and exceeding customer expectations in every product we deliver.  

    - Collaborative Growth: We foster open cooperation with research institutions, universities, and industry partners to create shared value and mutual success.  

    - Innovation and Learning: We continuously explore new scientific frontiers, improve our technologies, and encourage ongoing employee development to stay at the forefront of biotechnology.

     

    Mission:  

    To advance scientific research and healthcare innovation worldwide by providing premium-quality peptides, supporting the development of healthier lives and a brighter future.

     

    FAQ

    1 What types of peptides do you manufacture?

    We specialize in a variety of high-purity peptides, including custom peptides, research-grade peptides, cosmetic peptides, and peptide lyophilized powders and raw materials for pharmaceutical applications.

    2 What is the typical purity of your peptides?

    Our peptides are typically 99% pure, and we provide detailed COA (Certificate of Analysis).

    3 What if I need technical support after purchasing?

    Our technical and sales support team are always here to answer any questions you may have before or after your purchase. Please contact us via WhatsApp or email or form, we will usually respond within 12 hours.

    4 Do you ship internationally?

    Yes, we ship to over 35 countries and regions worldwide and provide full order tracking. If you have special shipping requirements, please let us know in advance.

    5 What payment methods do you accept?

    We support multiple secure payment methods, including: BTC/ETH/USDT/USDC/Alipay/etc.

    6 How long does it take to process and ship my order?

    Standard peptides: We will send out the goods within three days after receiving your payment, and the estimated delivery time is 5~15  days.

      Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 1 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 2 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 3 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 4 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 5 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 6 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 7 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 8 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 9 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 10 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 11 Shop LL-37 Peptide Powder 5mg CAS 154947-66-7 | High-Quality LL-37 Raw Powder | Trusted Product from China-Detailed Image 12

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,Skincare

    Location:

    Room 801, T095, No. 169 Haibin Road, Nansha Street, Nansha District, Guangzhou City

    Average lead Time:

    365

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.