Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 Peptide 5mg High Purity Research Grade Powder
LL-37 Peptide 5mg High Purity Research Grade Powder buy - large image1
LL-37 Peptide 5mg High Purity Research Grade Powder buy - image1
LL-37 Peptide 5mg High Purity Research Grade Powder buy - image2
LL-37 Peptide 5mg High Purity Research Grade Powder buy - image3
LL-37 Peptide 5mg High Purity Research Grade Powder buy - image4
LL-37 Peptide 5mg High Purity Research Grade Powder buy - image5
LL-37 Peptide 5mg High Purity Research Grade Powder buy - image6

LL-37 Peptide 5mg High Purity Research Grade Powder

TDS 1 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

深圳

Brand:

xh

Packaging:

5mg*10vials

Price valid (until):

2026-08-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales Manager: Iris
    WhatsApp: +852 9420 0597
    Email: xinhong6@zj-xinhong.com

    Product Name

    LL-37 Peptide 5mg High Purity Synthetic Research Peptide

    Product Description

    LL-37 Peptide is a synthetic bioactive peptide consisting of 37 amino acids. It belongs to the cathelicidin peptide family and is widely used as a research material in biochemical studies related to peptide science, molecular interactions, and biological activity evaluation.

    This product is supplied as a high-purity lyophilized powder with strict quality control. It is suitable for laboratory research, analytical applications, and peptide-related scientific investigations.

    Key Features

    • High purity synthetic peptide material
    • Lyophilized powder form for improved stability
    • Defined molecular structure and sequence
    • Suitable for biochemical and laboratory research applications
    • Available with quality documentation including COA and analytical data

    Product Information

    Product Name: LL-37 Peptide
    Synonyms: LL-37, Cathelicidin LL-37, CAMP
    CAS No.: 154947-66-7
    Molecular Formula: C205H340N60O53
    Molecular Weight: Approx. 4493.3 g/mol
    Appearance: White to off-white lyophilized powder
    Purity: ≥99% (HPLC)
    Form: Freeze-dried powder
    Storage: Store in a cool, dry place; recommended low-temperature storage for long-term stability


    Applications

    LL-37 Peptide can be used in:

    • Peptide structure and function research
    • Molecular interaction studies
    • Biochemical assay development
    • Cell biology research
    • Academic and industrial laboratory investigations

    Packaging

    Available packaging options:

    • 5mg/vial
    • Customized packaging available according to customer requirements

    Disclaimer

    For research use only. Not intended for human consumption, medical use, or diagnostic applications.

    Shop LL-37 Peptide 5mg High Purity Research Grade Powder-Detailed Image 1
    Shop LL-37 Peptide 5mg High Purity Research Grade Powder-Detailed Image 2
    Shop LL-37 Peptide 5mg High Purity Research Grade Powder-Detailed Image 3
    Shop LL-37 Peptide 5mg High Purity Research Grade Powder-Detailed Image 4
    Shop LL-37 Peptide 5mg High Purity Research Grade Powder-Detailed Image 5

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

    Location:

    Block 1, No. 205, Tongbao Road, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province (within Zhejiang Juzhiyun Holding Co., Ltd., on the 4th floor of 2 buildings)

    Payment Terms:

    TT against copy of documents,O/A,100% TT in advance

    Total Employees:

    101-200

    Year of Establishment:

    2026

    Company Profile

    Yiwu Xinhong Trading Co., Ltd. is a professional trading company engaged in the international supply and distribution of peptides, chemical raw materials.
    Leveraging a reliable network of qualified manufacturers and strategic partners, we provide customers with high-quality products, competitive pricing, and efficient supply chain solutions. Our products are widely used in pharmaceutical research, biotechnology, chemical manufacturing, laboratory research, and various industrial applications.

    With extensive experience in international trade, we are committed to helping customers source quality chemical products from China through professional procurement services, strict supplier selection, and reliable logistics support. We focus on building long-term partnerships by delivering consistent quality, responsive communication, and dependable service.

    Main Products
    Peptides
    Chemical Raw Materials
    Organic Chemicals
    Inorganic Chemicals
    Fine Chemicals
    Our Advantages
    Professional international trading services
    Reliable supplier network
    Competitive pricing and flexible sourcing
    Strict quality control and supplier management
    Fast response and efficient communication
    Global export and logistics support
    Business Scope

    Global sourcing, international trade, import and export of chemical products, customized procurement solutions, and supply chain services.

    Markets

    Europe, North America, South America, Southeast Asia, the Middle East, and other international markets.

    Yiwu Xinhong Trading Co., Ltd. is committed to providing professional chemical sourcing solutions and creating long-term value for customers worldwide. We look forward to establishing mutually beneficial partnerships with clients across the globe.

    Business Type: Trading Company
    Company Name: Yiwu Xinhong Trading Co., Ltd.
    Main Business: Peptides, Chemical Raw Materials
    Market: Global

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.