Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - large image1
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - image1
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - image2
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - image3
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - image4
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - image5
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale buy - image6

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale

TDS 1 Inquiries

Unit Price:

$40-50/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

ZWXS

Packaging:

5mg per vial;10vial/box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    we sale full list with peptide products , any other requirements just contact me!

    Name:sophia           

    email:   zwxs4@zwxstech.com

    WhatsApp: 13791008332 

     


      • Description:

        • Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

          The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

          we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

          This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!

        • Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 1
        • Application:

          1. LL37 has been used as an antimicrobial agent to improve wound healing.

          2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

          3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

          4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

          5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

          6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

        • Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 2
        • Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 3
        • Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 4
        • Items Specifications
          Items Specifications

          CAS RN

          154947-66-7

          Appearance

          White Powder

          Purity

          99%

          Storage condition

          -20℃
        • Application:

          1. LL37 has been used as an antimicrobial agent to improve wound healing.

          2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

          3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

          4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

          5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

          6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

        • Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 5



    Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 6

    Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 7

    Shop Cagrilintide CAS 1415456-99-3 high quantity Weight loss peptides Pure Cagrilintide raw powder-Detailed Image 1


    Shop PNC-27 CAS 1159861-00-3  High quality PNC27  Peptide raw powder 10mg vials-Detailed Image 2


    Our customers are all over the world, mainly selling in the United States, Canada, Australia, the United. Kingdom, the Ne  therlands, Germany, France and other EU countries, Southeast Asia, South America, and Oceania. We also have many customers.
     Our business is based on honesty and mutual trust. Sincerely look forward to establishing long-term mutually beneficial business relationships with customers around the world.

    Shop High Purity Hot Sales Motsc Mots-C CAS 1627580-64-6 Peptide-Detailed Image 6 Shop High Purity Hot Sales Motsc Mots-C CAS 1627580-64-6 Peptide-Detailed Image 7

    Shop High Purity Hot Sales Motsc Mots-C CAS 1627580-64-6 Peptide-Detailed Image 9 Shop High Purity Hot Sales Motsc Mots-C CAS 1627580-64-6 Peptide-Detailed Image 10 Shop High Purity Hot Sales Motsc Mots-C CAS 1627580-64-6 Peptide-Detailed Image 11

    Shop High Purity Hot Sales Motsc Mots-C CAS 1627580-64-6 Peptide-Detailed Image 12


      FAQ 


      Q1:How to send order?


      A:Send order list to us,we quote best price for you,then ship package out and offer tracking nubmer to you after payment send.

      Q2:Do you have samples for our reference?


    A:Sure,we can offer smaples,the customers will pay the freight.

      Q3:Any discount if order more?


    A:Sure,the price is negotiable,you can get much better price if order big quantity.

     Q4:What about the delivery time?


    A:Ship within 1-2 days after confirming payment (excluding Chinese holidays).5-7 days to arrive your address.

     Q5:What kind of payment terms do you accept?


    A:Payment can be made by Bank transfer, BTC,Credite Card,TT,Paypal,Alipay,Wechat,Visa,Mastercard,Appple Pay,Goolge Pay.


     Our Company


    Jinan Zhiwen Technology Co., Ltd.The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!


    Shop PNC-27 CAS 1159861-00-3  High quality PNC27  Peptide raw powder 10mg vials-Detailed Image 4 Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 17 Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 18



      Packaging  


    Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 19


    Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 20

    Company Profile

        Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the  province.

    Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7  Factory direct sale-Detailed Image 21

     We supply large quantities of peptides.In addition to regular specifications, we can also customize according to customer requirements.
     The minimum order quantity is 1 box(10vials), we welcome customers to order samples for testing.Please contact us for COA or HPLC.
     We believe that as long as the quality is good enough will lead to long-term cooperation.Looking forward to your inquiry.


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 41-9, Fenghuangshan Road, Beiyuan Street, Tianqiao District, Jinan City, Shandong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.