Product
Supplier
Encyclopedia
Inquiry
LL37 99% buy - large image1
LL37 99% buy - image1
LL37 99% buy - image2
LL37 99% buy - image3
LL37 99% buy - image4
LL37 99% buy - image5
LL37 99% buy - image6

LL37 99%

TDS 1 Inquiries

Unit Price:

$60/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

Shenzhen

Brand:

lq

Packaging:

5mg

Price valid (until):

2026-08-21

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Items Specifications
    Product Name LL37 / Cathelicidin LL-37
    CAS No. 154947-66-7
    Appearance White lyophilized powder
    HPLC Purity ≥99%
    Standard Package 20℃, sealed, avoid light & repeated freeze-thaw
    Application In-vitro laboratory antimicrobial research

    

    Product Overview

    LL37, also named Cathelicidin LL-37, with CAS registry number 154947-66-7, is a high-purity synthetic antimicrobial peptide exclusively produced for in-vitro laboratory research use. The finished product is white lyophilized powder processed by vacuum freeze-drying technology, which effectively locks the intrinsic biological activity of peptide molecules and reduces activity loss during long-term storage and cross-border transportation. This synthetic peptide is strictly limited to closed laboratory cell and microbial testing experiments, and it is not developed or approved for any human administration, cosmetic addition or oral application.
    As the only human-derived cathelicidin antimicrobial peptide, LL37 has become a core research material in the fields of microbiology, cell immunity and epithelial barrier mechanism study worldwide. Its unique dual functions of broad-spectrum bacteriostasis and immune regulation make it widely adopted in academic laboratories and biomedical research institutions for exploring the interaction between host cells and pathogenic microorganisms.

    Distinct Product Advantages for Laboratory Research

    1. Ultra-High Purity & Traceable Batch Inspection

      Every production batch of LL37 peptide undergoes dual quality detection by HPLC and mass spectrometry before factory delivery. The complete batch test certificate including HPLC chromatogram and mass spectrum molecular weight verification report is provided with each shipment, which can be directly filed for academic paper data traceability and laboratory internal record management. The total miscellaneous peptide impurity content is strictly controlled below 1%, eliminating experimental data interference caused by impure fragments.
    2. Low-Temperature Vacuum Lyophilization Activity Lock Technology

      We adopt professional vacuum freeze-drying processing instead of simple air-drying treatment. This technology can maintain the complete spatial secondary structure of LL37 peptide molecules without denaturation. Even if the product is exposed to room temperature environment for 3–5 days during international air or sea logistics, the loss of biological activity can be controlled within an acceptable range for short-term laboratory test arrangement.
    3. Broad-Spectrum Antimicrobial & Immune Regulation Dual Activity

      LL37 owns natural broad-spectrum inhibiting effect against gram-positive bacteria, gram-negative bacteria and partial fungi strains. Meanwhile, it can regulate the migration, proliferation and cytokine secretion of epithelial cells and immune cells, which makes it an ideal research reagent for simultaneous exploration of antibacterial mechanism and innate immune response pathway. Compared with other short-chain antimicrobial peptides, LL37 has lower cytotoxicity to mammalian cells, ensuring reliable repeatability of cell co-culture experiments.
    4. Independent Small-Dose Vacuum Sealed Vial Packaging

      The standard 0.1mg single vial design avoids irreversible activity loss caused by repeated opening of large-capacity bulk packaging. Each glass vial is sealed with butyl rubber stopper and aluminum cover under vacuum condition, effectively isolating moisture and oxygen in air to slow down peptide degradation. Small-scale laboratory teams with limited experimental volume can use one vial at a time without wasting unused raw peptide powder.
    5. Neutral Customized Packaging & Complete English Documentation Support

      We support neutral blank vial packaging without factory logos for laboratory internal research use. All batch inspection documents adopt standard English laboratory format, including purity analysis report, endotoxin detection record and production batch traceability form, which can be directly archived by overseas research institutions without secondary translation or format adjustment.

    Restricted In-Vitro Laboratory Research Application Scope

    This peptide reagent is only allowed to be operated in closed biosafety cabinets by trained professional laboratory technicians, and all application scenarios are limited to in-vitro cell and microbial experiments, with no human-related application permission. The main applicable research directions are listed as follows:
    • In-vitro broad-spectrum antibacterial activity test against gram-positive and gram-negative pathogenic bacteria
    • Basic research on the barrier repair mechanism of epidermal and mucosal epithelial cells
    • Exploration of innate immune signal transduction pathway triggered by antimicrobial peptide binding cell receptors
    • Comparative study of peptide cytotoxicity to mammalian primary cells and tumor cell lines
    • Construction of in-vitro infection cell models for basic biomedical research
    • Optimization of antibacterial additive formula for serum-free cell culture medium

    Strict Quality Control & Global Cold Chain Delivery Arrangements

    1. Full Aseptic Production Workflow

      The whole synthesis, ion-exchange purification, desalination, sterile filtration and split-packaging process is completed in dust-free aseptic workshop. No exogenous pyrogen, microbial contamination or heavy metal residue will be introduced into the peptide powder, so it can be directly dissolved and added to sensitive primary cell culture systems without additional secondary sterilization steps.
    2. Multi-Item Mandatory Batch Inspection Before Shipment

      Before packaging and shipment, each production batch will finish three non-negotiable inspection procedures: visual appearance inspection, HPLC purity quantitative testing, and mass spectrum molecular weight identification. All unqualified batches will be completely discarded and will not flow into global market to avoid affecting customer experimental progress.
    3. Constant Low-Temperature Cold Chain Logistics Protection

      All sealed vial packages are placed in insulated foam boxes filled with professional phase-change cold storage ice packs. The cold insulation box can maintain stable low-temperature environment for more than 96 hours during long-distance international transportation, ensuring the biological activity of LL37 peptide remains intact upon arrival at overseas laboratories.
    4. Flexible Customized Service for Research Clients

      We support customized split packaging specifications according to customer’s specific experimental demands. For bulk orders over 100 vials, we can provide exclusive customized batch testing standards and tailored English COA documents matching the institutional filing requirements of universities and research laboratories.

    Mandatory Laboratory Safety Notice

    This product is a dedicated in-vitro biochemical research reagent, and it is neither pharmaceutical raw material nor cosmetic additive. Laboratory operators must wear disposable nitrile gloves, dust-proof masks and protective goggles when dissolving or handling the lyophilized peptide powder. Direct contact with human skin and mucous membrane, oral intake, as well as any form of injection operation are strictly prohibited. After the completion of all experiments, residual peptide solution and empty vial waste must be classified as biochemical hazardous waste and disposed of in accordance with local laboratory waste management regulations. Keep the product sealed and stored out of reach of non-laboratory staff and minors at all times.

    Platform Image Upload Compliance Guidelines

    1. Upload limit: Up to 12 images per product listing; acceptable file formats: JPG, JPEG, PNG; single file size must be less than 3MB; recommended pixel size for all uploaded pictures: 800×800px.
    2. Suggested image display sequence: close-up shot of white lyophilized LL37 peptide powder, sealed glass vial packaging details, HPLC purity test spectrum, laboratory cell culture experiment scene, cold chain insulated shipping box real shot, batch COA document preview.
    3. Compliance rule: No contact information such as telephone numbers, email addresses, instant chat tool logos, QR codes or website links can be printed or added on any uploaded product images.
    Shop LL37 99%-Detailed Image 1
    Shop LL37 99%-Detailed Image 2
    Shop LL37 99%-Detailed Image 3
    Shop LL37 99%-Detailed Image 4
    Shop LL37 99%-Detailed Image 5
    Shop LL37 99%-Detailed Image 6
    Shop LL37 99%-Detailed Image 7
    Shop LL37 99%-Detailed Image 8
    Shop LL37 99%-Detailed Image 9
    Shop LL37 99%-Detailed Image 10
    Shop LL37 99%-Detailed Image 11
    Shop LL37 99%-Detailed Image 12
    Shop LL37 99%-Detailed Image 13
    Shop LL37 99%-Detailed Image 14
    Shop LL37 99%-Detailed Image 15

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Plot 1, No. 205 Tongbao Road, Jiangdong Subdistrict, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.