Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - large image1
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image1
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image2
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image3
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image4
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image5
3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image6

3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply

TDS 1 Inquiries

Unit Price:

$153/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

customizable

Packaging:

10 bottles per box

Price valid (until):

2026-08-27

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GHK-CU,RETATRUTIDE

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Contact Information  





    WhatsAPP:+86 15550069263
    Email:leila96292338@gmail.com



      Factory Overview 


    Guangzhou Changkai Trading Co., Ltd. is a high-tech enterprise specializing in peptide drugs. We are committed to providing the global biomedical industry with full-cycle, one-stop peptide drug CRDMO services, encompassing early discovery, preclinical research, clinical development, and commercial production. With our mission of "making peptide drugs more accessible", we have become a significant force in the domestic and even global peptide industry, leveraging our core technological expertise and large-scale production advantages in the field of peptide synthesis.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 1 Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 2 Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 3


      Product Detail  


    Tirzepatide is a dual GIP and GLP-1 receptor agonist studied for its effects on incretin signaling, glucose regulation, appetite pathways, and body composition. By activating two complementary metabolic receptors, Tirzepatide offers researchers a broader model than GLP-1-only compounds. It is commonly evaluated in studies focused on insulin response, satiety signaling, energy balance, and comparative metabolic outcomes across single-agonist and dual-agonist peptide platforms. Taken together, these characteristics position the material for structured studies where pathway-specific activity, comparative response, and consistency across experimental conditions matter.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 4

    Tirzepatide generally produces greater average weight loss than semaglutide and is often better tolerated, although both medications have similar gastrointestinal side-effect profiles.

    Items Specifications
    Category Peptides
    Bottle Color Transparent
    Purity 99%
    Specification 5mg, 10mg, 15mg, 20mg, 30mg, etc


    What is a peptide?

    Peptides are small molecules that lie between amino acids and proteins. They have a smaller molecular weight and do not require decomposition. They can be directly absorbed and utilized by the human body, with a much higher utilization rate than ordinary proteins.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 5
    The peptide products available on the market have undergone process purification to remove large molecular impurities, making them suitable for daily body supplementation. As people age, their body's ability to synthesize peptides decreases, leading to problems such as skin sagging, slowed metabolism, and reduced physical strength. Exogenous supplementation can fill the gap.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 6
    Oral peptides can regulate the body's condition, repair internal cells, improve sleep quality, regulate basal metabolism, and help maintain energy; topical skin care peptides can soothe fine lines, firm the skin texture, and repair the damaged skin barrier.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 7
    This product is gentle in composition and suitable for most skin types, differentiating it from ordinary health supplements. By taking it in appropriate amounts on a daily basis, it can improve one's complexion from within and delay signs of aging. The peptides are absorbed quickly and cause little burden on the stomach and intestines. Whether for daily maintenance or for people who stay up late or have irregular sleep schedules, it is suitable as a long-term maintenance option to achieve a state improvement from the inside out.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 8


    Peptide classification
    Peptides are mainly classified based on their molecular structure into large molecule polypeptides, small molecule oligopeptides, as well as dipeptides and tripeptides. According to their application directions, they can be further divided into two categories: cosmetic peptides and health-promoting active peptides.
    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 9
    Health-promoting active peptides can be rapidly absorbed by the digestive system and participate in body metabolism. They can repair body cells, regulate immunity, alleviate fatigue and weakness, and also regulate blood sugar and lipid levels, nourish the stomach and intestines, repair the mucosa, slow down the aging of body functions, and are suitable for the daily treatment of people with sub-health conditions.
    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 10

    Certificates
    • 3710 Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GHK-CU,RETATRUTIDE

    Location:

    Guangzhou Changkai Trading Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Employees:

    Less than 5

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.