Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Oxidising > LL-37 for Sale > CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - large image1
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - image1
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - image2
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - image3
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - image4
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - image5
CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation buy - image6

CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2028-08-21

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Anne
    WhatsApp: +852 6462 7346

    Shop TR30 TR40 TR50 TR60 CAS2023788-19-2 Transport safety is improving rapidly-Detailed Image 1

    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop XA5 XA10 SK5 SK10 TSM5 CAS129954-34-3 It has received high praise in the market-Detailed Image 2

    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop TR30 TR40 TR50 TR60 CAS2023788-19-2 Transport safety is improving rapidly-Detailed Image 3

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop TR30 TR40 TR50 TR60 CAS2023788-19-2 Transport safety is improving rapidly-Detailed Image 4

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop SM2 SM5 SM10 SM15 SM20 CAS910463-68-2 Ensure safe delivery-Detailed Image 5
    As a leading peptide manufacturing powerhouse, we specialize in producing high - quality peptides with unmatched precision and consistency. Our state - of - the - art facilities are equipped with advanced synthesis and purification technologies, ensuring that each peptide product meets the highest industry standards. Whether it's pharmaceutical - grade peptides for research and development, functional peptides for nutraceuticals, or cosmeceutical peptides for skincare applications, we offer a comprehensive range of solutions.
    Shop CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation-Detailed Image 6
    We also offer a wide variety of peptide types, such as oligopeptides, polypeptides, and modified peptides. Oligopeptides, with their small molecular size, are highly absorbable and ideal for applications where rapid penetration and bioavailability are crucial, like in dietary supplements aimed at boosting immune function or promoting muscle recovery. Polypeptides, on the other hand, are well - suited for complex biological functions and are frequently used in the development of therapeutic drugs. Modified peptides, which can be customized with specific chemical groups, open up new possibilities for targeted drug delivery and enhanced stability.
    Shop TR30 TR40 TR50 TR60 CAS2023788-19-2 Transport safety is improving rapidly-Detailed Image 7
    Our production process adheres to strict quality control protocols, from raw material sourcing to final product packaging. With a team of experienced scientists and technicians, we can customize peptide sequences according to specific client requirements, providing tailor - made solutions for diverse industries. Our commitment to innovation, reliability, and customer satisfaction makes us the preferred partner for all your peptide manufacturing needs.

    Shop CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation-Detailed Image 8

    Shop TR30 TR40 TR50 TR60 CAS2023788-19-2 Transport safety is improving rapidly-Detailed Image 9

    Shop TR30 TR40 TR50 TR60 CAS2023788-19-2 Transport safety is improving rapidly-Detailed Image 10

    Shop CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation-Detailed Image 11

    Certificates
    • CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Factory quotation Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Oxidising

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.