Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Blood Glucose Regulators > LL-37 for Sale > LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - large image1
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - image1
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - image2
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - image3
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - image4
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - image5
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit buy - image6

LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit

TDS 3 Inquiries

Unit Price:

$35-36/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

shenzhen

Brand:

SUITAITRADE

Packaging:

5MG/vails 10vails/box

Price valid (until):

2026-09-03

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

peptide,Cosmetics

  • Product Description

  • Seller Information

  • Inquiry History

  • Description



    Description

    Name: Stella

    Telegram:+852 6482 4426

    Whatsapp:+852 6482 4426
    Email Address: geng@suitaitrade.com
    Shop Retatutide-Detailed Image 1










    ——Basic Info.——
    Items Specifications Items Specifications
    Model NO. LL37 Export Market Global 
    Quality Pharmaceutical grade Grade Pharmaceutical Grade
    Appearance White powder Transport Package Box
    Storage Dry and Cool Place Content Appearance 99
    Arrival Time 5-8 days Packaging 5MG/vial,10vials/box
    Origin China port shenzhen/guangzhou
                                       






    ——Product Description——

     
    Product Name: LL37
    CAS:  

     

    154947-66-7

    Shelf life: 24 months
    Specification: 2MG/5MG/vial 10vials /box
    Appearance:

    Lyophilized powder







    ——What is LL37 ——


    T hy malin is a natural polypeptide complex extracted from  calf thymus glands , containing various biologically active small protein molecules (peptides). It is not a single compound, but a natural combination of multiple thymic hormones that mimic the function of a young, healthy thymus.

    Thy ma lin is a natural polypeptide complex extracted from calf thymus glands, essentially a set of synergistic bioactive signaling molecules. Its core function is to  reboot and optimize the immune system's "command center" —the thymus, an organ that atrophies with age, leading to declining bodily defenses. By delivering key "instructions" necessary for normal thymic function, Thymalin promotes the maturation and training of new immune cells and coordinates communication between different immune components. This helps the body respond more intelligently to infections, aging, and stress. It not only enhances weakened immune function but also balances excessive immune responses. In the field of anti-aging, it demonstrates unique potential—by revitalizing thymic function, it may delay immune senescence, improve tissue repair capacity, and even enhance overall vitality. Though it has decades of clinical use in countries like Russia, it remains a regenerative medicine tool requiring professional guidance rather than a mainstream supplement.
    Key Features:
    Ultra-High Purity & Stability: ≥99% purity verified by HPLC/MS, with consistent molecular structure across batches.
    Endotoxin-Free & Sterile: Produced in a cleanroom environment, free from endotoxins, microbial contamination, and residual solvents.
    Precision Dosing & Consistency: Each vial is accurately weighed and vacuum-sealed under sterile conditions, eliminating dosage errors.
    Multiple Specifications Available: Standard options include 10mg per vial; custom specifications and OEM packaging are also supported.
    Full Application Compatibility: Ideal for academic research, pharmaceutical development, pre-clinical trials, and metabolic disorder studies.

    Product Storage:
    For optimal stability and activity preservation, store GDF-8 at -20°C or below in a dry, dark environment. Avoid repeated freeze-thaw cycles, as this may degrade the peptide structure. For long-term storage (over 6 months), we recommend aliquoting the peptide into smaller portions and storing them at -80°C. Before use, allow the vial to reach room temperature, then reconstitute the peptide with sterile water or bacteriostatic water according to your specific research requirements.

    Documentation & After-Sales Support:
    Every order of GDF-8comes with a complete set of supporting documents, including a Certificate of Analysis (COA), HPLC report, MS spectrum, and a detailed Technical Data Sheet (TDS). These documents provide full traceability and meet the compliance requirements of research institutions and pharmaceutical companies. Our professional technical support team is also available to assist you with storage guidance, reconstitution methods, and any other questions related to the product.



    ——Product Pictures——
    Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 2 Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 3 Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 4 Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 5 Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 6 Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 7





    ——Our Factory——
    Shop Retatutide-Detailed Image 5 Shop Retatutide-Detailed Image 6

    ——Customer Testimonials ——Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 10

    Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 11

    Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 12





    ——Our Advantages——
    Shop Retatutide-Detailed Image 7

    ——Packing——
    Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 14

    ——Before & After Results——
    Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 15


       ——Shipping Method——
    Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 16

    ——FAQ——

    • 1.What research fields is LL37?

      LL37 is a novel triple GLP‑1/GIP/GCGR agonist peptide, mainly used in preclinical laboratory research related to type 2 diabetes, blood glucose regulation and obesity pathogenesis, widely adopted by pharmaceutical R&D institutions and biochemical labs for metabolic disease studies.

    • 2.How should LL37be stored to retain biological activity?
      Product activity is susceptible to repeated freezing and thawing. Short-term sealed storage at −20°C in dark dry environment; long-term preservation needs storage below −80°C. Thaw to room temperature before experimental preparation and avoid frequent temperature changes


    • 3.What payment methods do you accept?
      We support multiple flexible payment options, including wire transfer, USDT (TRC20 & ERC20) and other mainstream methods. You may pick the one that works best for you.

      4.Is sample service available before bulk order?
    • Sure, we provide sample support for all products. Regular items can be sent as free samples, you only cover the shipping fee. For high-value Snap-8 peptide, a small product fee plus freight will be charged. Long-term cooperative clients and VIP customers can enjoy free sample service anytime.


    • 5.What advantages do you have compared with other suppliers?
    • Professional and experienced R&D personnel to guarantee product stability.
    • Complete production capacity, supporting orders from gram level to ton level.
    • Well-equipped production workshops and testing laboratories.
    • Rigorous quality inspection system and professional testing instruments, each batch tested by HPLC and MS.
    • Safe and reliable logistics solutions specially for chemical goods delivery.
    • Thoughtful and timely after-sales support.
    • Premium product quality and standardized protective vial packaging.
    • Products manufactured in line with ISO related standards.
      Shop LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit-Detailed Image 17


    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide,Cosmetics

    Location:

    FLAT E19, 10/F, NO .52 HUNG TO ROAD, KWUN TONG HONG KONG

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Introduction to Peptide Manufacturing Factory
    Our peptide manufacturing factory is a professional, standardized and intelligent production base dedicated to the research, development and mass production of high-purity custom peptides and standard peptides. Adhering to strict pharmaceutical and biochemical production standards, we integrate independent R&D, precision production, rigorous quality testing and customized technical services, committing to providing high-quality peptide products and reliable solutions for global customers.
    Equipped with advanced fully automated peptide synthesis production lines, purification systems and freeze-drying equipment, the factory supports multi-scale production ranging from milligram-level laboratory samples to kilogram-level industrial mass production. We cover mainstream synthesis technologies such as solid-phase peptide synthesis and liquid-phase peptide synthesis, and can efficiently customize various complex peptides, including long-chain peptides, cyclic peptides, modified peptides, fluorescent-labeled peptides and phosphorylated peptides. Our product portfolio widely serves biopharmaceutical research, cosmetic raw material development, food additive production, academic scientific research, diagnostic reagent preparation and other fields.
    Quality control is the core of our production management. The factory has built a complete quality management system in line with ISO international standards, with independent professional testing laboratories. We adopt high-performance liquid chromatography (HPLC), mass spectrometry (MS), infrared spectroscopy and other precision testing methods to strictly monitor raw material screening, synthesis reaction, purification treatment, finished product packaging and every production link. This ensures that all peptide products feature high purity, stable properties, accurate molecular weight and low impurity content, meeting the differentiated quality requirements of scientific research experiments and industrial production.
    With a professional technical team composed of senior peptide synthesis engineers and biochemical researchers, we have rich experience in solving difficult peptide synthesis problems and optimizing production processes. While guaranteeing product quality and production efficiency, we continuously optimize production processes, reduce production costs and shorten delivery cycles. In addition, we provide one-stop services including peptide design scheme optimization, technical consultation, after-sales technical support and personalized packaging, winning long-term trust and cooperative relationships with customers at home and abroad.
    Sticking to the development concept of "technology innovation, quality supremacy, customer-oriented", our factory keeps upgrading production equipment and R&D capabilities, and strives to become a competitive professional peptide manufacturing supplier in the global biochemical industry.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.