Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 5 Excellent quality Safety Certified Professional-Grade Cost effective
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - large image1
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - image1
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - image2
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - image3
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - image4
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - image5
LL37  5   Excellent quality Safety Certified Professional-Grade Cost effective buy - image6

LL37 5 Excellent quality Safety Certified Professional-Grade Cost effective

3 Inquiries

Unit Price:

$78-80/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

SH

Packaging:

5mg

Price valid (until):

2026-10-10

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Acetic acid water,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Sales manager :Mia
    Whatsapp:+85247318942

    Email:zhenbo202601@163.com









    Shop TirzepatideTR2Fast delivery High purity Weight loss peptide-Detailed Image 1 Shop TirzepatideTR2Fast delivery High purity Weight loss peptide-Detailed Image 2 Shop TirzepatideTR2Fast delivery High purity Weight loss peptide-Detailed Image 3


    Company Introduction
    Qingdao Fengxi Biotechnology Co., Ltd.is a professional manufacturer and supplier specializing in high-purity peptide products and fine chemical raw materials. We integrate independent research and development, production, sales and global logistics to provide stable, reliable and cost-effective products for customers worldwide.

    We own a professional R&D team and a mature international logistics system, ensuring stable product quality, safe packaging and fast delivery. Our products are widely exported to the United States, Europe, Japan, South Korea, India and other regions. Most mainstream peptide products are always in sufficient stock and support immediate shipment. We sincerely welcome global customers to inquire and customize, and we will provide you with the most competitive quotation based on your purchasing quantity.

    Our peptide products are widely applied in life science research, pharmaceutical development, cosmetic raw materials, anti-aging industries and functional health fields. All products maintain stable purity and superior quality with favorable market prices. Our long-term cooperative customers have always given positive feedback on product quality, stability and after-sales service.


    1. Superior Product Quality 

    Quality control is our core advantage. All peptides are synthesized by advanced solid-phase peptide synthesis (SPPS) technology, strictly purified by HPLC high-performance liquid chromatography and fully tested and verified by MS mass spectrometry.

    Every batch of goods comes with complete official COA (Certificate of Analysis), including full test data:

    - HPLC purity
    - MS molecular weight confirmation
    - Moisture / water content
    - Residual solvent test
    - Microbial limit test (as required)


    For customers with high-standard laboratory and regulatory requirements, we can also provide third-party independent test reports, LAL endotoxin data and stability test documents.


    2. Customization & R&D Support 

    We provide flexible one-stop custom synthesis services, supported by an experienced technical R&D team. We support customized peptide sequences, cosmetic-grade customized purity and various molecular modification technologies such as acetylation and PEGylation.


    Our main technical services cover:

    - Custom peptide synthesis (mg to kg large-scale production)
    - Peptide modification and marker customization
    - Small molecule compound synthesis
    - New product research, project development and production scale-up


    We always communicate closely with customers to ensure technical rationality, stable quality, fast cycle and reasonable cost control in the whole development process.


    3. Wide Product Portfolio 

    We own a complete and continuously updated product line to meet diversified market demands:

    - Research peptides & GLP-1 series: Semaglutide, Tirzepatide, Retatrutide and other weight-loss & blood-sugar regulating analog peptides
    - Cosmetic peptides: Acetyl Hexapeptide-8, Matrixyl and anti-aging skin care peptides
    - Anti-aging health raw materials: NMN, NR, NADH and NAD+ booster series
    - Biochemical raw materials: Amino acid derivatives, enzyme materials and laboratory custom reagents

    We continuously launch new products to follow the latest market trends, and support long-term batch reservation and stable supply for regular customers.
    Items Specifications
    LL37 5mg*10vials
    LL37 10mg*10vials


    1.:We offer various types of peptides,about the peptides,we can provide the good quality,the good price.
    Customers who have ordered our products(peptides)have had very good feedback.
    World wide relaible buyers can contact us about the peptides.

    2:Company advantages

    Are you from these countries?United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.
    Good News! We guarantee smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.

    Why Choose Us:
    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.
    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.
    Easy Payment: Pay with Bitcoin,USDT, or bank transfer.
    Good Quality: Our products are great, and we support small test orders.

    3:FAQ

    Q1:Are you a supplier or a manufacturer?
    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?
    A:We have strong cooperation with Special express line, FEDEX, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?
    A:, Bitcoin.USDT.Alipay

    Q4:How is the after-sales service?
    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?
    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

    Q6: How to confirm the Product Quality before placing orders?
    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    Q7:Is there any discount?
    A:Yes, for larger quantity, we always support with better price
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Acetic acid water,Tirzepatide

    Location:

    Room 2701-A046,Building 2,No.76 Lianyungang Road,Shibei District,Qingdao City,Shandong Province,P.R.China

    Year of Establishment:

    2023

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.