Product
Supplier
Encyclopedia
Inquiry
Exenatide141758-74-9 buy - large image1
Exenatide141758-74-9 buy - image1
Exenatide141758-74-9 buy - image2
Exenatide141758-74-9 buy - image3
Exenatide141758-74-9 buy - image4
Exenatide141758-74-9 buy - image5

Exenatide141758-74-9

4 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

141758-74-9

Grade:

pharmaceutical grade

Content:

99%

Port:

1

Brand:

Ipure

Packaging:

25kg/Cardboard Drum

Sample Available:

Yes

Price valid (until):

2026-10-16

Company Type:
Trader
Location:
Hongkong, China
Payment Terms:
TT against copy of documents,D/P,L/C,O/A,100% TT in advance
Average Lead Time:
10 days
Qualification:
Main Products:

pharmaceutical intermediates,chemical

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Shop Enclomiphene citrate 7599-79-3  .Top quality-Detailed Image 1 Shop Enclomiphene citrate 7599-79-3  .Top quality-Detailed Image 2 Shop Enclomiphene citrate 7599-79-3  .Top quality-Detailed Image 3



    Our company HONGKONG IPURE CHEMICAL CO., LIMITED is a diversified product production and operation enterprise, with API, pharma intermediates, and other fine chemicals as well as R&D and pigments development and sales as one of the large enterprises, with more than 130 acres of plant in accordance with GMP production requirements.The pharmaceutical intermediates are mainly applied to anti-cancer, anti-depression, cardiovascular, diabetes and other new medicine. The chemical intermediates mainly refer to heterocyclics and OLED intermediates.The company built new factory to produce new fine chemical materials which are mainly used in water treatment, bactericidal and anti-corrosion, dyes, electronic materials and other industry fields. Our company enjoys a high reputation in China for its high standard, low price and comfortable service of high quality chemical products.

    we also have a strong team of professional R&D technology.we have about 300 employees, including 90 full-time PHD 15 PHD and masters above, 153 undergraduates, with reasonable professional knowledge structure and adequate staffing.

    We have imported sets of high-efficiency and high-sensitivity analytical instruments, such as high-pressure liquid chromatography, gas chromatography and ultraviolet spectrophotometer, to effectively analyze and monitor the products. The company has passed quality system certification. The products are exported to North America, South America, Europe, Australia Japan, Korea and other country . High quality products and good service are deeply trusted and praised by customers at home and abroad.
    Best purity! Best Service !

    Professional Transportation and After-Sales Service Description for International Trading Company

    HONGKONG IPURE CHEMICAL CO., LIMITED Global Logistics & Customer Support Commitment

    At HONGKONG IPURE CHEMICAL CO., LIMITED, we understand that a successful international transaction does not end with the shipment of goods. Our comprehensive Transportation Management and After-Sales Service is designed to provide seamless, reliable, and transparent support from the moment your order is confirmed until the final delivery and beyond. We act as your strategic partner, ensuring not just the movement of cargo, but the integrity and success of your entire supply chain.

    1. Core Transportation Services & Coordination:
    We manage the entire logistics lifecycle, offering tailored solutions for various shipment types.

    · Sea Freight (FCL/LCL): We provide competitive rates and reliable schedules with major shipping lines for Full Container Load (FCL) and consolidated services for Less than Container Load (LCL), covering major global ports.
    · Air Freight: For urgent or high-value shipments, we coordinate expedited air freight solutions with trusted carriers to ensure speed and security.
    · Multi-Modal Transport: We design and execute complex shipments involving combinations of sea, air, rail, and truck transport for door-to-door delivery.
    · Special Cargo Handling: Expertise in handling sensitive goods, including hazardous materials (with proper MSDS & documentation), oversized cargo, and temperature-controlled products.

    2. After-Sales & Post-Shipment Support Services:
    This is where we add exceptional value, turning logistics into a competitive advantage for you.

    · Real-Time Shipment Tracking & Proactive Updates:
    · End-to-End Visibility: We provide access to an online tracking platform or regular email updates, allowing you to monitor your shipment's status in real-time—from factory pickup to port arrival, vessel departure, and final destination.
    · Proactive Notification: Our team proactively informs you of any schedule changes, potential delays, or documentation milestones, ensuring you are never caught off guard.
    · Documentation Support & Customs Clearance Assistance:
    · Accurate Document Preparation: We meticulously prepare, check, and process all critical international trade documents (Commercial Invoice, Packing List, Bill of Lading/Air Waybill, Certificates of Origin, etc.) to ensure compliance and avoid port delays.
    · Customs Guidance: We provide essential guidance and documentation support for both export (China) and import (destination country) customs clearance processes. While final import clearance is the importer's responsibility, we equip your partner with all necessary, accurate documents.
    · Exception Management & Issue Resolution:
    · Dedicated Support Channel: A dedicated post-shipment contact person or team is assigned to handle any inquiries or issues that arise during transit.
    · Problem-Solving: In case of unforeseen events (e.g., port congestion, customs holds, vessel deviations), we immediately liaise with carriers, agents, and insurers on your behalf to find the fastest and most cost-effective solution. We manage communications to minimize impact on your operations.
    · Insurance & Claims Assistance:
    · Cargo Insurance: We facilitate the arrangement of comprehensive marine/all-risk cargo insurance to protect your goods against loss or damage during transit.
    · Claims Support: In the unfortunate event of damage or loss, we provide expert guidance and support throughout the insurance claims filing process, helping you gather required evidence and documentation.
    · Customer Communication & Relationship Management:
    · Regular Follow-ups: We conduct post-delivery follow-ups to ensure the goods were received in good order and services met your expectations.
    · Continuous Improvement: We value your feedback and use it to continuously refine and improve our logistics processes and service quality.

    Our Commitment:
    We are committed to being more than just a vendor. By choosing HONGKONG IPURE CHEMICAL CO., LIMITED you gain a logistics partner dedicated to transparency, reliability, and proactive communication. Our after-sales service ensures that you have peace of mind and can focus on your core business, knowing that the complexities of international shipping are in expert hands.

    Let us handle the logistics complexities, so you can focus on growing your global business.

    ECHEMI Editorial Reference
    Exendin-4 is a 39 amino acid polypeptide and incretin mimetic involved in the glucose-dependent enhancement of insulin secretion. It was first isolated from Gila monster saliva. It also promotes the reduction of hyperglycemia, glucose-dependent suppression of inappropriately high glucagon secretion, slowing of gastric emptying, and reduction of food intake, often with body weight reduction or blunting of weight gain. The synthetic form, Exenatide, is a glucagon-like peptide-1 (GLP-1) agonist approved for the treatment of diabetes mellitus type II, has a long half-life.

    Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. 


    ChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.
    Exendin-4 is an incretin mimetic peptide, which is composed of 39 amino acids. It is an analog of glucagon-like peptide 1 (GLP-1), and an insulinotropic agent, with a long half-life. Exendin-4 was historically isolated from the venom of Gila monster lizard calledHeloderma suspectum.
    Exendin-4 Recombinant produced in E.Coli is a non-glycosylated polypeptide chain containing 39 amino acids and having a molecular mass of approximately 4.2kDa. Exendin-4 is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Exendin-4

    Other Name:

    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide (Exendin-4);Exenatide free base;XENDIN-4;EXENDIN-4;M.W. 4186.61 C184H282N50O60S;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

    CAS No.:

    141758-74-9

    Molecular Formula:

    C184H282N50O60S

    InChIKeys:

    HTQBXNHDCUEHJF-AAPNSGCPNA-N

    Molecular Weight:

    4186.57188

    EC Number:

    686-356-3

    Color/Form:

    White to off-white

    HScode:

    2933290000

    Characteristics
    Water Solubility:

    Soluble in water (1 mg/ml)

    Critical Temperature & Pressure:

    −20°C

    Research
    Class:

    GLP-1 receptor agonist (exendin-based, 39-amino-acid peptide)

    Status:

    FDA-approved (Byetta 2005, Bydureon 2012)

    Mechanism:

    A synthetic 39-amino-acid peptide (exendin-4) that acts as a GLP-1 receptor agonist. It is not a GLP-1 analog but shares 53% sequence homology with human GLP-1. Exenatide enhances glucose-dependent insulin secretion, suppresses glucagon, slows gastric emptying, and reduces food intake. Bydureon is the extended-release formulation.

    EC50 (GLP1R Ic50):

    3.22 nM

    Source:

    Exendin-4 binding data: Eng J, et al. J Biol Chem. 1992;267(11):7402-7405. DrugBank: DB01276.DOI

    Clinical Development:

    NCT00053397

    FDA:

    Byetta, Bydureon BCise (approved 2005-04-28)

    References
    ChEMBL:

    CHEMBL486

    DrugBank:

    DB01276

    KEGG DRUG:

    D04104

    PubChem:

    PubChem

    Disclaimer:

    Exenatide is FDA-approved as a prescription medicine (Byetta, Bydureon) for type 2 diabetes. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    pharmaceutical intermediates,chemical

    Location:

    Company Office Address: Room 1508, 15/F, Yate Centre Office Tower 2, 625 Nathan Road, Mong Kok, Hong Kong

    Payment Terms:

    TT against copy of documents,D/P,L/C,O/A,100% TT in advance

    Average lead Time:

    10 days

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025


    Established in 2011 and headquartered in Wuhan the largest metropolitan center in Central China

    HongKong Ipure chemical co.,ltd  is a leading integrated enterprise specializing in the research, development, production, and sales of high-purity biotechnology products.

     

    Our diversified portfolio includes Active Pharmaceutical Ingredients (APIs), pharmaceutical intermediates, fine biochemicals, and high-performance pigments. Operating from a modern manufacturing campus spanning over 130 acres, our facilities are designed and maintained in strict compliance with GMP standards, ensuring excellence across every stage of production.

     

    Supported by a dedicated team of approximately 300 professionals, our R&D and technical staff include over 90 experts with doctoral and masters degrees, complemented by 153 specialists holding bachelors degrees. This highly qualified team drives continuous innovation and maintains our competitive edge in technology and product development.

     

    To guarantee precision and consistency, we employ advanced analytical instrumentation including High-Performance Liquid Chromatography (HPLC), Gas Chromatography (GC), and UV Spectrophotometers for rigorous in-process monitoring and final product validation. Our commitment to quality is further demonstrated by ISO 9001 certification, which underpins our operational and managerial systems.

     

    Ipure Chemical  serves a growing international clientele across North and South America, Europe, Australia, Japan, South Korea, and beyond. We are consistently recognized for delivering products of exceptional purity, reliability, and value, backed by responsive and customer-focused service.

     

    Ipure Chemical Excellence in Purity. Commitment in Service.


      Company Profile  


  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Philippines

    Exenatide (CAS: 141758-74-9)

    10 G Sep 19, 2026
    Philippines

    Exenatide

    10 G Aug 13, 2026
    Philippines

    Exenatide

    10 G Sep 16, 2026
    United States

    Exenatide

    Mar 11, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.