Exenatide141758-74-9
4 Inquiries
141758-74-9
pharmaceutical grade
99%
1
Ipure
25kg/Cardboard Drum
Yes
2026-10-16
pharmaceutical intermediates,chemical
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceExendin-4 is a 39 amino acid polypeptide and incretin mimetic involved in the glucose-dependent enhancement of insulin secretion. It was first isolated from Gila monster saliva. It also promotes the reduction of hyperglycemia, glucose-dependent suppression of inappropriately high glucagon secretion, slowing of gastric emptying, and reduction of food intake, often with body weight reduction or blunting of weight gain. The synthetic form, Exenatide, is a glucagon-like peptide-1 (GLP-1) agonist approved for the treatment of diabetes mellitus type II, has a long half-life.
Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia.
ChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.
Exendin-4 is an incretin mimetic peptide, which is composed of 39 amino acids. It is an analog of glucagon-like peptide 1 (GLP-1), and an insulinotropic agent, with a long half-life. Exendin-4 was historically isolated from the venom of Gila monster lizard calledHeloderma suspectum.
Exendin-4 Recombinant produced in E.Coli is a non-glycosylated polypeptide chain containing 39 amino acids and having a molecular mass of approximately 4.2kDa. Exendin-4 is purified by proprietary chromatographic techniques.Basic Info-
Product Name:
Exendin-4
Other Name:HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide (Exendin-4);Exenatide free base;XENDIN-4;EXENDIN-4;M.W. 4186.61 C184H282N50O60S;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
CAS No.:141758-74-9
Molecular Formula:C184H282N50O60S
InChIKeys:HTQBXNHDCUEHJF-AAPNSGCPNA-N
Molecular Weight:4186.57188
EC Number:686-356-3
Color/Form:White to off-white
HScode:2933290000
Categories:
Characteristics-
Water Solubility:
Soluble in water (1 mg/ml)
Critical Temperature & Pressure:−20°C
Research-
Class:
GLP-1 receptor agonist (exendin-based, 39-amino-acid peptide)
Status:FDA-approved (Byetta 2005, Bydureon 2012)
Mechanism:A synthetic 39-amino-acid peptide (exendin-4) that acts as a GLP-1 receptor agonist. It is not a GLP-1 analog but shares 53% sequence homology with human GLP-1. Exenatide enhances glucose-dependent insulin secretion, suppresses glucagon, slows gastric emptying, and reduces food intake. Bydureon is the extended-release formulation.
EC50 (GLP1R Ic50):3.22 nM
Source:Exendin-4 binding data: Eng J, et al. J Biol Chem. 1992;267(11):7402-7405. DrugBank: DB01276.DOI
Clinical Development:FDA:Byetta, Bydureon BCise (approved 2005-04-28)
References-
ChEMBL:
CHEMBL486
DrugBank:KEGG DRUG:PubChem:Literature:Disclaimer:Exenatide is FDA-approved as a prescription medicine (Byetta, Bydureon) for type 2 diabetes. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.
Hazard IdentificationClassification of the substance or mixture
Carcinogenicity, Category 2
Reproductive toxicity, Category 2
GHS label elements, including precautionary statements
Pictogram(s)
Signal word Warning
Hazard statement(s) H351 Suspected of causing cancer
H361 Suspected of damaging fertility or the unborn child
Precautionary statement(s) Prevention P203 Obtain, read and follow all safety instructions before use.
P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response P318 IF exposed or concerned, get medical advice.
Storage P405 Store locked up.
Disposal P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.
Other hazards which do not result in classification
no data available
Handling and StoragePrecautions for safe handling
Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.
Conditions for safe storage, including any incompatibilities
Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
pharmaceutical intermediates,chemical
-
Location:
Company Office Address: Room 1508, 15/F, Yate Centre Office Tower 2, 625 Nathan Road, Mong Kok, Hong Kong
-
Payment Terms:
TT against copy of documents,D/P,L/C,O/A,100% TT in advance
-
Average lead Time:
10 days
-
Total Annual Revenue:
$1 million-$2.5 million
-
Total Employees:
11-50
-
Year of Establishment:
2025
-
-
Inquiry History4 Inquiries
Country Product Purchase Quantity Date Posted
Philippines
Exenatide (CAS: 141758-74-9)
10 G Sep 19, 2026
Philippines
Exenatide
10 G Aug 13, 2026
Philippines
Exenatide
10 G Sep 16, 2026
United States
Exenatide
5 Mar 11, 2026 Post an enquiry for this product
More from this Seller
-
-
-
N-Methyl-2-(4-Methylpiperazin-1-yl)-N-(4-nitrophenyl)acetaMide 1139453-98-7 in stocks
pharmaceutical grade / 99%
-
-
-
-
Coluracetam135463-81-9
pharmaceutical grade / 99%
-
-
-
-
2-Methyl anthraquinone .smoke white .high purity 98%.top quality
Pharmaceutical Grade / 98%
-
-
-
-
1,3-Dimethylbarbituric acid Original manufacturer sells high-purity stock
pharmaceutical grade / 99%
-
-
-
-
Elagolix sodium 832720-36-2 in stocks
Pharmaceutical Grade / 99%
-
-
-
-
Magnesium Sulphate Heptahydrate10034-99-8
pharmaceutical grade / 99%
$1/G FOB
-