Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - large image1
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - image1
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - image2
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - image3
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - image4
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - image5
LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder buy - image6

LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder

TDS 3 Inquiries

Unit Price:

$58/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

guangzhou

Brand:

chunqiao

Packaging:

10mg*10vials, 10 vials/kit

Price valid (until):

2026-10-17

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Key Specifications/ Special Features:

    why did you choose us


    Our peptide products are of high quality and advanced technology. We not only offer excellent transportation services but also provide worry-free after-sales support. Our company has over a decade of experience in the peptide industry and has always treated customers with integrity. We have hundreds of peptide products to meet the needs of customers. We have business cooperation with America, Europe, Australia and even all over the world, and have maintained long-term and stable cooperative relationships.


    Guangzhou Chunqiao  Technology Co., Ltd.  has been a biotech enterprise engaged in the R&D, production, and sales of peptides and raw materials for more than more years.

    The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects.Exporting to Europe, the USA, Canada, and AustraliaThe company has a full sales service system, and its products are exported to countries worldwide, including Europe, the USA, Canada, and Australia.

    It has won a good international reputation for its excellent quality and services. The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers.Customization Service AvailableWe can customize and develop various corresponding products according to customers' special requirements, and provide customers with strong technical support and a complete set of industry solutions.

    Shop LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder-Detailed Image 1 Shop LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder-Detailed Image 2

    Key Specifications/ Special Features:


    • Peptide products is a high-quality product and with stock and safe shipping service. we have 200 kinds+ peptides for option and with business all over the world establish stable cooperation relationship.
    • Stock: hotsale items with enough stock for shipment , also accept custom order with vials caps and bigger dose.
    • Shipping time: 3-10 days with DHL and UPS shipping line.
    • Peptide Form: Lyophilized Powder

     Shop Global bestseller Peptide peptides fitness peptide Cheap Price Peptide China Peptides Safe Delivery Peptide Raw Peptide-Detailed Image 3

    How to complete your order:


    • Step 1: Please tell me your preferred items, quantity and destination country.
    • Step 2: You confirm all details and submit your purchase order.
    • Step 3: We will send the detailed price of the product and provide suitable shipping methods for your reference.
    • Step 4: You must confirm the order and payment 100% in advance and send us your detailed contact information, including contact person/company, address, mobile phone number, postal code and your special requirements.
    • Step 5: We will arrange shipment according to your requirements. Tracking codes will be provided once shipment is completed. You can track your package at any time.
    • Step 6: We provide after-sales service. We will provide service after you receive the package.
    • Shop Vasoactive Intestinal Peptide VIP 28 Amino Neuropeptide Research Grade Powder-Detailed Image 4
    • FAQ

      Q1. How do you ensure product quality?

      1. We have a strict quality management system in place. All batches must pass tests and meet our standards before being released into the warehouse.2. We will recheck and confirm product quality before delivery.3. We can send samples to a third-party testing agency to obtain a testing report if necessary.

      Q2. Do you offer samples?

      We can provide samples for most of our products free of charge. Please cover the cost of express shipping.

      Q3. What is your lead time for a new order?

      For most products in stock, the delivery time is 3-5 business days after payment receipt. For customized products, please discuss further. Q4: Are you manufacturer or trading company?

      We are manufacturer, peptides are our main product.

      05.What is our MOQ?

      A:One box,ten vials per box.

      06.Have your Product Quality been Approved by Third Party Lab?

      A: Yes, we can provide COA and lab test report. So you will be assured with Good Quality if you choose us.

      07.Is OEM logo and packaging available ?

      A:Yes,we can customize your logo colors on products and make personalized packaging.

      08.What is our shipping methods?

      A:According to your countries, different countries, different shipping methods for safe and fast delivery

      Shop Global bestseller Peptide peptides fitness peptide Cheap Price Peptide China Peptides Safe Delivery Peptide Raw Peptide-Detailed Image 5

      Shop Factory peptides China peptide high purity peptide 10mg Research peptides peptides peptides peptides peptide chemical peptide 60mg-Detailed Image 6


    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL-37 Cathelicidin Antimicrobial Host Defense Peptide Research Powder Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Unit 1-B2141, 19B-F1, 81-1 Nonglinxia Road, Yuexiu District, Guangzhou, China

    Year of Establishment:

    2026

    Company Profile
     

    Guangzhou Chunqiao Trading Co., Ltd.

    established in 202 6  and headquartered in Guangzhou  Province, is a comprehensive foreign trade enterprise integrating the research and development of peptides, raw material procurement, and sales. With a registered capital of 1 million USD and international certifications, our business spans 30 countries and regions, achieving an annual export volume exceeding 200 million USD. Leveraging a global supply chain system and a digital trading platform, we are dedicated to providing high-quality products and customized procurement solutions for overseas customers.

    Core Business and Products
    Our core operations encompass a cross-border trade agency, offering end-to-end services including import and export customs declaration, logistics clearance, and foreign exchange settlement. We also provide OEM/ODM services, specializing in product design, production, and private label processing for international brands. Furthermore, our supply chain management expertise allows us to integrate high-quality domestic manufacturing resources, establishing a vertical supply network from raw materials to finished goods. Our key product lines are in the chemical industry, focusing on raw materials, and the organic sector, featuring organic ecological products and plant extracts.
    Core Competitiveness

    • Full-chain service system: Establish a four-dimensional integrated system encompassing procurement, quality inspection, logistics and after-sales service, implementing a 48-hour rapid response mechanism with a customer complaint rate below 0.5%.

     

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.