99% Purity Raw Peptides Powder High Quality LL 37 99% White powder CAS 154947-66-7
TDS 3 Inquiries
154947-66-7
High Purity Grade
99%
Shenzhen
Tong Peptides
10mg/vial, 10 vials/box
Yes
2027-02-05
retatrutide,TB-500,GHK-CU,peptide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceLL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.Research & Reference Note
99% Purity Raw Peptides Powder High Quality LL 37 99% White powder CAS 154947-66-7 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
CertificatesBasic Info-
Product Name:
LL-37
Other Name:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS No.:154947-66-7
Molecular Formula:C205H340N60O53
InChIKeys:POIUWJQBRNEFGX-XAMSXPGMSA-N
Molecular Weight:0
EC Number:211-519-9
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
-
-
Seller Information
-
Business Type:
Manufactory
-
Main Products:
retatrutide,TB-500,GHK-CU,peptide
-
Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing
-
Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance
-
Total Annual Revenue:
$10 million-$25 million
-
Total Employees:
501-1000
-
Year of Establishment:
2023
-
-
Inquiry History3 Inquiries
Country Product Purchase Quantity Date Posted
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL-37
5 MG Jun 23, 2026 Post an enquiry for this product
- Hot Searches
- propylene glycol products
- 5 aminolevulinic acid price
- heavy water for sale
- o que é sesame oil
- dimethylmercury
- bulk retatrutide
- dicalcium phosphate supplier
- retatrutide peptides where to buy
- where to buy anhydrous ammonia
- where to buy anhydrous ammonia
- benzoic acid vs sodium benzoate
- buy ammonium nitrate fertilizer online
More from this Seller
-
-
-
NP810 High-quality peptides,white powder,provide home delivery service-available in stock
Pharmaceutical Grade / 99%
$16-18/MT FOB
-
-
-
-
CU50|Factory Direct Sale|99% High Purity and Quality|Fast and Safe Shipping|Door-to-Door Delivery|Customs Clearance and Insurance|After-Sale Service
Pharmaceutical Grade / 99%
$2/UNIT FOB
-
-
-
-
High Quality BT10 TB500 Peptide Factory price Fast delivery China Warehouse
Pharmaceutical Grade / 99%
$66-72/MT FOB
-
-
-
-
OT2|China Factory Directly Supply|High >99% Purity Peptide|Lyophilized Powder|Fast and Safe Delivery|On Time Arrival|Customs Clearance and Insurance
Pharmaceutical Grade / 99%
$2/UNIT FOB
-
-
-
-
G25|Factory Direct Supply|>99% High Purity and Quality Peptide|Fast and Safe Shipping|Door-to-Door Delivery Service|Customs Clearance and Insurance
Pharmaceutical Grade / 99%
$2/UNIT FOB
-
-
-
-
Retatrutide RT60 60mg*10vials high quality, fast and safe delivery, on time arrival
Pharmaceutical Grade / 99%
$120-135/MT FOB
-
