 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 99% freeze dried powder cas154947-66-7 senwayer//

LL37 99% freeze dried powder cas154947-66-7 senwayer// buy - large image1

LL37 99% freeze dried powder cas154947-66-7 senwayer// buy - image1

LL37 99% freeze dried powder cas154947-66-7 senwayer// buy - image2

LL37 99% freeze dried powder cas154947-66-7 senwayer// buy - image3

LL37 99% freeze dried powder cas154947-66-7 senwayer// buy - image4

LL37 99% freeze dried powder cas154947-66-7 senwayer//

4 Inquiries

Unit Price:

$88/MT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Port:

tianjin

Packaging:

boxed

Price valid (until):

2026-11-15

Contact Supplier

 Chat Now

Jingdezhen Shengtian Tuyuan Trading Co., Ltd.

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average Lead Time:

11 days

Qualification:

Main Products:

Peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

cas	154947-66-7
Name	LL37
Synonyms	SUNTHEANINE THEANINE,L N5-ethyl-L-glutamine theanine L-TheaMine
MF	C205H340N60O53
Purity	99%
Application	Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

cas154947-66-7 LL37 benefits

Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

Shop LL37 99% freeze dried powder cas154947-66-7 senwayer//-Detailed Image 1

Shop LL37 99% freeze dried powder cas154947-66-7 senwayer//-Detailed Image 2

Shop LL37 99% freeze dried powder cas154947-66-7 senwayer//-Detailed Image 3

Shop LL37 99% freeze dried powder cas154947-66-7 senwayer//-Detailed Image 4

Shop LL37 99% freeze dried powder cas154947-66-7 senwayer//-Detailed Image 5

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Basic Info

Characteristics

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
Peptide

Location:
Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
11 days

Year of Establishment:
2025

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Mini Package LL37 Peptide Raw Powder Individual Vial Custom Label	Pharmaceutical Grade/99	$22/UNIT FOB	HONG KONG BURSON POLYPEPTIDE R&D LIMITED	Inquiry
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sales	Pharmaceutical Grade/99	$80-100/MT FOB	Jinan Zhiwenxinsheng Electric Technology Co., Ltd.	Inquiry
LL37\|Factory Direct Supply\|Weight Management Lyophilized Powders\|99% High Pure\|Fast and Safe Shipping\|Door-to-Door Delivery Service\|Custom Clearance	Pharmaceutical Grade/99	$2/UNIT FOB	Tong peptides	Inquiry
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply	Research Grade/99	$90/UNIT FOB	Yiwu Nianwu	Inquiry
LL37 \| Factory sales 375\| Cosmetic Peptides \| 99% Purity \| 5mg 10mg Vials \| Lyophilized Powder	Pharmaceutical Grade/99.99	$65/UNIT FOB	Yiwu Weitai Trading Co., LTD	Inquiry

LL37 99% freeze dried powder cas154947-66-7 senwayer//

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller