 Home > Cosmetic Ingredient > Dissolving Agent > LL-37 for Sale > TR50 TR60 RT5 CAS154947-66-7 BT10 375 CU50 CU100 NJ1000 GT600(Brand) GT1500 cagrilintide

TR50 TR60 RT5 CAS154947-66-7 BT10 375 CU50 CU100 NJ1000 GT600(Brand) GT1500 cagrilintide

TDS 4 Inquiries

Unit Price:

$1/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

Packaging:

10 mg / 15mg/ 20 mg / 30 mg / 10 tubes per box

Sample Available:

Yes

Price valid (until):

2027-02-01

Contact Supplier

 Chat Now

Chengtai Co., Ltd.

Company Type:

Trader

Location:

Hongkong, China

Average Lead Time:

1 days

Qualification:

Main Products:

 Visit Store

Product Details
Seller Information
Inquiry History

Description
Product Detail
Sales manager: Hailev

WhatsApp：+852 4702 2871

The importance of peptides

Many active substances in the human body are in the form of peptides. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

Appearance: Powder
Purity: >99% (or refer to the Certificate of Analysis)
Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
Solubility: To be determined
Shelf Life: >2 years if stored properly
Drug Formulation: To be determined
Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

Company Profile

We are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad.  We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.

With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.

At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

FAQ

1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you.

2. What's the lead time and shipping ways?
We will delivery to the package by USPS, FEDEX, DHL paket and UPS express to you after receive your payment, it would take around 5-15 days to your address.

3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

4. What's the payment methods ?
We could accept pay through paypal,bank transfer, XTransfer and bitcoin.

Why Choose Us

Our company has independent factories, mass production of pharmaceutical intermediates, organic intermediates and other raw materials, widely used in medicine, health care products, cosmetics, nutritional supplements, food additives and other fields.

Our company adheres to the business philosophy of integrity and cooperation. scientific innovation and service first.With absolute quality assurance as the purpose and perfect service system as the basis, our company provides efficient and satisfactory consulting services, sincerely welcomes your business inquiries,and looks forward to working with you to create a new future.

Key Products:
Our primary focus encompasses a range of products, including weight loss peptides, medicinal peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Semaglutide, Tirzepatide, Retatrutide, and others.

transportation

We usually use a safe shipping method and do not require you to go through any customs clearance. Free shipping to your address without worrying about any customs issues. We have a professional customs clearance team that 100% guarantees the safe delivery of your package. If anything happens to your package, we promise to send it again for free. Enjoy the second free reissue policy.

Q&A

Q1: Are you a supplier or a manufacturer?
A: We are both a supplier and a manufacturer.
Q2: How do you make the delivery?
A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
Q3: What payment methods do you accept?
A: We accept Bitcoin and USDT.
Q4: How about the after-sales service?
A: We offer high-quality products and guarantee 100% safe delivery.
Q5: How do you ensure product quality?
A: We will send you the analysis report (COA) of the sample to confirm the quality.
Q6: How can we verify the quality of the products before placing an order?
A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
Q7: Are there any discount offers?
A: Yes, the larger the order quantity, the more favorable the price will be .

Type of Shipping

We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure the timeliness of shipment, rapid delivery, stable logistics tracking, and safe and punctual delivery.

Payment Details
Payment Method PayPal
ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Dissolving Agent

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water

Research

Class:
Amylin receptor (AMYR) / calcitonin receptor (CTR) agonist (long-acting amylin analog)

Status:
Investigational — Phase 3 (REDEFINE program, CagriSema combination)

Mechanism:
A novel long-acting, acylated amylin (islet amyloid polypeptide, IAPP) analog consisting of 38 amino acids. Cagrilintide activates the amylin receptor (AMYR) and calcitonin receptor (CTR), reducing food intake, delaying gastric emptying, and promoting satiety. Being developed as monotherapy and in fixed-dose combination with semaglutide (CagriSema) for obesity.

Activity note:
Cagrilintide is a non-selective AMYR/CTR agonist. Specific EC50 values not publicly available; functional potency is comparable to native amylin at AMYR.

Source:
MCE: Cagrilintide (CAS 1415456-99-3); Novo Nordisk REDEFINE program.

Clinical Development:
NCT05249895; NCT05249882

References

PubChem:
PubChem

Literature:
MCE: Cagrilintide (CAS 1415456-99-3); ClinicalTrials.gov: REDEFINE-1 (NCT05249895); Novo Nordisk: EASD 2025 Cagrilintide data presentation

Disclaimer:
Cagrilintide is NOT FDA-approved or EMA-approved. It is in Phase 3 clinical trials (REDEFINE program). This listing is for industrial and laboratory research use only. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Seller Information

Business Type:
Trader

Main Products:
tr

Location:
B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

Average lead Time:
1 days

Total Annual Revenue:
Less than $1 million

Total Employees:
5-10

Year of Establishment:
2026

20 years of production experience in peptide products

Safe and unobstructed shipping channels|High quality guaranteed|

Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity	Pharmaceutical Grade/99	$20-25/G FOB	Tianjin Apex Import and Export Trading Co., Ltd.	Inquiry
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price	Pharmaceutical Grade/99	$95/UNIT FOB	Beijing Novio Biotechnology Co., Ltd.	Inquiry
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide	Pharmaceutical Grade/99	$100/UNIT FOB	Enshi Technology Co., Ltd.	Inquiry
Mini Package LL37 Peptide Raw Powder Individual Vial Custom Label	Pharmaceutical Grade/99	$22/UNIT FOB	HONG KONG BURSON POLYPEPTIDE R&D LIMITED	Inquiry
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support	Pharmaceutical Grade/99	$50-60/UNIT FOB	Hainan Terte New Materials Co., Ltd.	Inquiry

TR50 TR60 RT5 CAS154947-66-7 BT10 375 CU50 CU100 NJ1000 GT600(Brand) GT1500 cagrilintide

Product Details

Seller Information

Inquiry History

20 years of production experience in peptide products

More Choices Find All Products for Sale 

Related Searches

More from this Seller