On ECHEMI

Euroscreen

Belgium
Favorite Supplier
 150 people visit

Company Profile

Euroscreen is a Belgium-based chemical company known for its innovative products and commitment to sustainability. Founded in the early 1990s, the company has grown to become a leader in the chemical industry, providing a wide range of products and services to customers around the world.


The company's expertise in developing and producing specialty chemicals has led to a diverse portfolio of products, including surfactants, emulsifiers, thickeners and preservatives. Euroscreen's products are known for their high quality, purity and efficiency and are used in applications such as cosmetics, pharmaceuticals and food processing.


In addition to its focus on products, Euroscreen is committed to sustainability and has implemented several initiatives to reduce its environmental impact, including the use of renewable energy and environmentally friendly production processes. Euroscreen is also committed to ethical business practices, fair labor standards and responsible sourcing.


VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

Adenosine

Adenosine;Adenine riboside;9-β-D-Ribofuranosyladenine;β-D-Adenosine;9H-Purin-6-amine,9-β-D-ribofuranosyl-;β-D-Ribofuranose,1-(6-amino-9H-purin-9-yl)-1-deoxy-;β-D-Ribofuranoside,adenine-9;β-Adenosine;Boniton;Myocol;Nucleocardyl;Sandesin;Riboadenosine;9-β-D-Ribofuranosyl-9H-purin-6-amine;D-Adenosine;Adenocard;Adenoscan;Adrekar;Adenocor;NSC 7652;24: PN: WO2007053194 SEQID: 49 claimed sequence;26: PN: WO2007053194 SEQID: 49 claimed sequence;27: PN: WO2007053194 SEQID: 49 claimed sequence;Adenogesic;NQZ-012;46946-45-6;46969-16-8
58-61-7 Inquiry

Adrenomedullin

H-TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2;H-TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2 (DISULFIDE BRIDGE: 16-21);ADM 1-52, HUMAN;ADRENOMEDULLIN (HUMAN);ADRENOMEDULLIN 1-52, HUMAN;YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (DISULFIDE BRIDGE: 16-21);TYR-ARG-GLN-SER-MET-ASN-ASN-PHE-GLN-GLY-LEU-ARG-SER-PHE-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-VAL-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-ASN-VAL-ALA-PRO-ARG-SER-LYS-ILE-SER-PRO-GLN-GLY-TYR-NH2;humanadrenomedullin
148498-78-6 Inquiry

Angiotensin

Angiotensin;Angiotonin;Angiotensins;1405-70-5;12642-17-0
1407-47-2 Inquiry

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

United States

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.