Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 Batch Fast Delivery Safe Transportation

Description

Sales Manager:Jane

Email: zwxs3@zwxstech.com

Whatsapp: +86 15634077884

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Appearance: Powder

1. Purity: >98% (or refer to the Certificate of Analysis)

   Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

   Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

   Solubility: To be determined

   Shelf Life: >2 years if stored properly

   Drug Formulation: To be determined

   Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

   HS Tariff Code: 2934.99.9001

   Product Specification 

We have many years of trading experience and are professional   Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

1.GMP factory guarantee good quality.

2.Offer factory competitive prices.

3.Rich experience for safe and fast shipping.

4.Twenty-four hours on-time service.