Basic Information

• Alias: rhPTH (1-34), Parathyroid Hormone Fragment 1-34 human
• CAS No.: 52232-67-4
• Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (34 amino acids)
• Molecular Formula: C₁₈₁H₂₉₁N₅₅O₅₁S₂
• Molecular Weight: ~4117.8 Da
• Appearance: White/off-white sterile lyophilized powder
• Solubility: Freely soluble in water, PBS, acidic aqueous solutions
• Storage: -20°C, protected from light & moisture; shelf life: 24 months

Core Mechanism & Applications (For Research Use Only)

• Mechanism: Potent agonist of PTH type 1 receptor (PTH1R); intermittent low-dose administration preferentially stimulates osteoblast activity, promoting bone formation over resorption.
• Key Research Uses:
  1. Osteoporosis & Bone Research: Increases bone mineral density (BMD), improves trabecular microarchitecture, and reduces vertebral fracture risk in preclinical models.
  2. Fracture Healing: Accelerates bone repair and enhances callus formation in fracture models.
  3. Metabolic Bone Disease: Studied for glucocorticoid-induced osteoporosis and hypogonadal bone lossFORTEO®.
  4. Pharmacology & Drug Development: Used for PTH1R signaling, anabolic bone therapy, and biosimilar development.

Premium Grade Features

• Purity: ≥99.0% (HPLC)
• Form: Sterile lyophilized powder; common specs: 1 mg/vial, 5 mg/vial, 10 mg/vial
• QC: Full third-party testing (purity, moisture, heavy metals, endotoxin, microbes) + COA provided
• Stability: Stable at -20°C; short-term storage at 4°C allowed
• Stock: In stock for immediate shipment

Quality Standard

• HPLC Purity ≥99.0%; single impurity ≤1.0%, total impurities ≤2.0%
• Water content ≤1.0% (Karl Fischer)
• Heavy metals ≤10 ppm; Arsenic ≤2 ppm
• Endotoxin <0.5 EU/mg; sterile grade
• Identity confirmed by HPLC, LC-MS, and amino acid sequencing