Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - large image1
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - image1
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - image2
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - image3
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - image4
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - image5
Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price buy - image6

Hot Selling Glucagon 16941-32-5 Factory Supply Raw Materials High Qulity Wholesale price

TDS 4 Inquiries

Unit Price: Get Latest Price
CAS No.:

16941-32-5

Grade:

USP / EP / BP / JP Grade

Content:

99.9%

Port:

shanghai

Brand:

Bocare

Packaging:

25kg/2kg Cardboard Drum

Price valid (until):

2026-06-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

pregabalin,Tirzepatide,Retatrutide,Food Additives,semaglutide,Cosmetics material

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 1





    Our Reference Specification, for more details, pls contact us for COA, MSDS and certification:

    Email : mia @bocarechem.com              Telephone:+8613378417783                 

    Mobile:+8613378417783;                      Whatsapp&Wechat:+8613378417783  


    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 2






    Items Standard
    Test Results

    Identification

    A.H-NMR:Comply with the structure
    Complies
    B.LC-MS:Comply with the structure
    Complies
    C.The IR spectrum of sample should be identical with that of reference standard.
    Complies
    D.HPLC-ESI-MS
    The retention time of the major peak in the chromatogram of the Assay preparation corresponds to that in the chromatogram of the Standard preparation, as obtained in the Assay.



    Complies
    Loss on drying % ≤2.0
    0.19
    Heavy metals ppm ≤10 
    <10
    Moisture % ≤1.0
    0.1
    Sulphated ash % ≤0.5 determined on 1.0 g.
    0.009
    Residue on ignition % ≤0.1
    0.03

    Related Substances %

    Unspecified impurities: for each impurity ≤0.10 <0.10
    Total Impurity ≤0.5 0.18
    Purity % ≥99.0
    99.7
    Assay % 99.0 ~101.0 (anhydrous substance).
    99.8
    Storage Preserve in well-closed, light-resistant and airtight containers.
    Complies



    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 3

     



     

               HuBei bocare Chem Co., Ltd. is a company specializing in the research, development, production, and sales of nutritional supplements, plant extracts, and other related products. With a focus on high-quality, natural ingredients and cutting-edge technology, we strive to provide our customers with safe and effective products to support their health and well-being.

    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 4   Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 5

    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 6   Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 7


              Our team of experienced professionals is committed to delivering innovative solutions and exceptional customer service. We work closely with our clients to understand their unique needs and develop customized products to meet their specific requirements. With a state-of-the-art manufacturing facility and strict quality control measures, we ensure that our products meet the highest standards of safety and purity.
    At HuBei bocare Chem Co., Ltd., we are dedicated to promoting a healthy lifestyle and providing our customers with the tools they need to achieve their wellness goals. Whether you are looking to improve your energy levels, support your immune system, or enhance your overall health, we have a range of products to meet your needs. We are committed to excellence in everything we do and look forward to working with you to achieve your health and wellness goals.


    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 8






    Shop Hot Selling Spiramycin 8025-81-8 Factory Supply Raw Materials High Qulity Wholesale price-Detailed Image 9




    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 10






    1.We are very experienced with this field(more than 10 years);
    2.Good after-sales service
    3.100% quality guaranteed;
    4.We accept sample order for testing;
    5.Strong supply ability


    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 11







    Shop Hot Selling Spiramycin 8025-81-8 Factory Supply Raw Materials High Qulity Wholesale price-Detailed Image 12


    Shop Manufacturer Supply Pregabalin crystal  148553-50-8 Pharmaceutical Grade for Drug Development and Research-Detailed Image 13 




    1.Are you a factory or trading company
    We are a company integrating manufacturer and trading company


    2.What products do you have
    We supplies Nootropic ingredients powder, Peptides (Such as Cosmetic peptide, Recombinant protein, Peptide intermediates,ect.), pharmaceutical intermediates (Such as Men's health ingredients, Cosmetic ingredients, Hair care Ingredients, Weight loss ingredients, Anti-cancer ingredients, Painkiller ingredients, etc.),  Health supplements ( Such as Food additives, Vitamins, Amino acid, Enzyme,ect.), Plant extracts


    3.How is the quality I want to test.
    Before production and extraction, we will test all raw materials.Quality is our top priority. All products are strictly tested and confirmed by our QC and QA, approved by Third Party Lab in China.So you will be assured with Good Quality if you choose us. We welcome you test the product and hope to get your feedback.


    4.Can I get a Free sample
    Yes, For most products we can provide you a free sample, You only need to pay for Shipping. Plesae be free to consult our salesman.
    For a larger quantity, we always support you with better price.


    5. What's your main payment method
    T/T (Bank transfer), WU, MoneyGram, Wechat,Alipay,Credit card payment.


    6.What modes of transportation do you have to choose
    We cooperate with HKEMS, DHL, TNT, UPS, FEDEX, EMS, China Air Post ,sea transportation etc.
    And with the SAFE SHIPPING in each country, you can receive the goods smoothly.It is fast and safe method.


    7.How long does it take to the goods arrived
    It is Depending on your location:
    5-7 days by DHL,UPS,TNT, FEDEX, HKEMS,Netherlands post.
    7-20 days by DDP special line.
    5-8 days by Air
    20-35 days by Sea


    8.How is the goods packed
    We usually send goods with disguise package outside and a double-layer sterile transparent bag inside.We have tried thousand of package methods, it looks serious and discreet.


    9.: How to proceed order
    Please Let me konw the product you are looking for,quantity and the destination country wihch help me to give you a right price;
    After you confirm all details of order, pay money in advance and give us Shipping address.We arrange the shipment at first time after receive payment and offer after-sales service after you receive parcel.


    10.When will I receive the shipping number Where I can check status of my order
    After the goods are sent out, our staff will send you the shipping number via email, online or WhatsApp ASAP.You can also check the status online on 17track.


    Certificates

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    pregabalin,Tirzepatide,Retatrutide,Food Additives,semaglutide,Cosmetics material

    Location:

    Jiuzhen Town, Tianmen City, Hubei Province

    Payment Terms:

    TT against copy of documents,L/C,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $50 million-$100 million

    Total Employees:

    101-200

    Year of Establishment:

    2025

    Hubei Bocare Chemical Co., Ltd. was founded in 2017, and located in Jiuzhen town, Tianmen City, Hubei Province, China. Now it is the

    leading researcher and one of the biggest manufacturer in high technology API area.


    There are 8 experts in our research team. We insist in innovation and produce high quality

    products. And GMP standard workshop and complete stainless extraction equipment.

    We have 2 sales departments over 20 people and sell our products all over the world.


    We also have strong professional research and development team, talented personnel and

    completely equipped laboratory for the quality controlling. Various Detection Device is

    equipped in Bocare company, such as HPLC, GC, Spectrophotometer, AAS, Polarimeter, Auto

    titrators, BOD Incubators, COD Incubators, Melting point apparatus and so on.


    Bocare mainly engaged in export of products including, without limitation, pharmaceutical raw

    materials both for vet and human, also Vitamins, Amino Acids, minerals, peptides, plant

    extract, feed and food additives.


    Our company's business is based on Honest, Trustworthy, Constantly to Go Beyond and

    Achieve Mutual Win. Sincerely hope to strengthen exchanges and cooperation with friends

    from both home and abroad.


    Passion to innovate, Power to deliver !

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.