Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 |  US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS 1 Inquiries

Unit Price:

$30/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99.9%

Port:

shanghai

Packaging:

5mg 10mg 15mg 20mg 30mg 40mg 50mg 60mg vials

Price valid (until):

2030-06-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Polypeptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    Shop Wholesale Price Body Building  Peptides MGF 1mg 2mg High Purity Overseas Warehouse Good Effect-Detailed Image 1

    1. STORAGE CONDITION

      Storage: Store at -20℃ degrees Celsius in a dry and cool place.

      Storage Condition: Store at -20°C Solubility in DMSO: 3mg/mL (0.73 mM)

      The storage conditions of  Semaglutide vary depending on the form. The powder should be stored at − 20 ° C for 3 years and 4 ° C for 2 years. After dissolved in solvent, it should be stored at − 80 ° C for 6 months and at − 20 ° C for 1 month. In addition, Semaglutide should be refrigerated before opening, and can be kept refrigerated or stored at room temperature for 56 days after opening.


      Our Service:

      1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

      2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

      3.We can send the goods to your delivery address directly. It is relatively safe and fast.

      4.Quick and clear response to customers questions.

      5.We could make our price discount if you place a substantial order with us.



    Product name LL37 CAS NO. 154947-66-7
    Purity 99% Molecular weight 4731.33
    Appearance White powder Molecular Formula C221H342N46O68
    Storage Frozen Function Weight loss
    Specifications 10mg/vial MNQ

    1 box of 10 vials


      Company Profile 



    Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 2 Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 3

    Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 4 Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 5


    Yiwu Jingpinhui Plastic Co., Ltd.  is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.


      Our advantages  


    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;  
    2. We will reply you for your inquiry in 24 hours;  
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .

    Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 6 Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 7 Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 8 Shop High Purity  Retatrutide Raw Powder Weight Loss Peptides  with Bulk Prices-Detailed Image 9


      FAQ 


    Q: How to store it?

    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

    Q: How to order this product?

    A: You can click "contact Supplier" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

    Q: How about the delivery time?

    A: Shipped within 48 hours after payment is received.Small orders are shipped via express door-to-door.The goods arrive in about7-10 days.

    Q: How much is the commodity?

    A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.

    You need to contact me to get the latest product price, we promise to give you the most favorable price.

    Q:About the after-sale service?

    A:After purchasing the products from our Company, we have a professional technical team and after-sales team to serve you and solve all your problems in the future.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Polypeptide

    Location:

    Yiwu City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,D/P,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Employees:

    5-10

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.