Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > BT5 BT10 375 CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - large image1
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - image1
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - image2
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - image3
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - image4
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - image5
BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation buy - image6

BT5 BT10 375 CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5mg/ 10mg/ 50 mg/ 100 mg. 10 bottles per box

Price valid (until):

2027-10-30

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——


    We supply premium lyophilized peptides with 99% high purity and factory direct competitive pricing. Our professional peptide products have gained favorable reviews from numerous laboratory and wholesale clients globally. Trustworthy purchasers are welcome to reach out for cooperation inquiries and bulk order quotations.

    We adopt professional cryopreservation and freeze-drying technology. All raw materials are stored at ultra-low temperature to maintain complete intrinsic biological activity and stable chemical properties.

    Simple reconstitution operation is available. Just dissolve the lyophilized powder with matched sterile solvent before use, and the product can restore full biological efficacy steadily.

    Our goods boast stable batch performance and reliable tested quality with complete COA documents. We strive to deliver cost-effective research peptides and thoughtful one-stop service.

    Feel free to get in touch if you have purchasing demands or related questions about specifications, purity and shipping. We sincerely hope to establish long-term stable partnerships and create mutual benefits together.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 T0R15 TR20 TR30 TR40 TR50 TR60 Inventory is sufficient-Detailed Image 1

       Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 2

    ——      Why Choose Us      ——

    1.We have more than 10 years of experience in the field of chemical industry, the company's products are exported to more than 60 countries overseas, of which 80% are exported to Europe and America, 20% are exported to Southeast Asia, the Middle East, South Africa and other regions.

    2.We have our own production plant and R & D center, to provide customers with technical support, product customization, free recipes and other whole industry chain services. Support full video inspection, testing, global delivery package.

    3.We accept sample orders for testing, after purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your future problems. 100% quality assurance, 100% safe delivery.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 T0R15 TR20 TR30 TR40 TR50 TR60 Inventory is sufficient-Detailed Image 3

    ——      Our advantage    ——

    We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 T0R15 TR20 TR30 TR40 TR50 TR60 Inventory is sufficient-Detailed Image 4

    We firmly believe that this freeze-dried powder boasts unparalleled comprehensive advantages in terms of quality, performance and value. If you have any questions about this product or want to know how it can add value to your business, please feel free to contact us at any time. We are always committed to providing excellent customer service to help our clients achieve their business goals.


    Benefits:


    1. Ultra-low temperature freezing: The highly active components are frozen at -196 degrees, causing them to enter a dormant state.


    2. Effective regeneration: When using, add a solvent to the powder, and after mixing, it can be effectively regenerated, ensuring the high activity and high stability of the product.


    We offer various types of peptides. We can provide high-quality products and competitive peptide prices.


    Customers who ordered our products (peptides) have given very positive feedback.


    Reliable buyers from all over the world can contact us for inquiries about peptides.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 T0R15 TR20 TR30 TR40 TR50 TR60 Inventory is sufficient-Detailed Image 5 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 T0R15 TR20 TR30 TR40 TR50 TR60 Inventory is sufficient-Detailed Image 6 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 T0R15 TR20 TR30 TR40 TR50 TR60 Inventory is sufficient-Detailed Image 7

    ——       Our factory      ——

    We are a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.

    As a leading peptide manufacturer,We have a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.

    In terms of production technology, We adopt internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.

    Our company adhere to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.

    In the future,We will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 8 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 9


    ——        Customer Feedback       ——

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 10 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 11


    ——      Packing & Delivery     ——

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 12 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 13 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 14


    Welcome to be our distinguished customer,please do not hesitate to contact us!

    Certificates
    • BT5 BT10 375  CU50 CU100 TB500 Thymosin B4 Acetate LL37 GHK-CU CAS154947-66-7 Factory quotation Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.