Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - large image1
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - image1
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - image2
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - image3
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - image4
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - image5
LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer buy - image6

LL37 99% Freeze-Dried Powder CAS 154947-66-7 Senwayer

1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.87%

Port:

上海

Brand:

Shun-zhi

Packaging:

box

Price valid (until):

2027-06-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Pls input...

     

    • Description


       

                                                                                                                                  Basic Info.  

       


      Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 1

      Cas No. 2023788-19-2 SDF

      Formula C225H348N48O68 M.Wt 4813.45

      Solubility Soluble in DMSO Storage Store at -20°C

      General tips For obtaining a higher solubility, please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.

      Stock solution can be stored below -20℃ for several months.

      Shipping Condition Secure Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis)

      Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

      Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

      Solubility: To be determined Shelf Life: >2 years if stored properly

      Drug Formulation: To be determined

      Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

      Category Peptides Purpose Weight Loss
      Bottle Color Transparent MOQ 10 Vials
      Purity 99% Storage Dry Cool Sealed Container
      Specification 5mg, 10mg, 15mg, 20mg, 30mg, etc Form Lyophilized Powder(Freeze-Dried Powder)
      Origin China Production Capacity 40000vials/Week



       

      Product Description  

       


       


      Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes. Tirzepatide (LY3298176) shows significantly better efficacy with regard to glucose control and weight loss than do Dulaglutide. Tirzepatide, also known as LY 3298176, is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. Tirzepatide has a greater affinity to GIP receptors than to GLP-1 receptors, and this dual agonist behavior has been shown to produce greater reductions of hyperglycemia compared to a selective GLP-1 receptor agonist. Signaling studies reported that tirzepatide mimics the actions of natural GIP at the GIP receptor. Tirzepatide was approved for improving blood sugar control in adults with type 2 diabetes, as an addition to diet and exercise.

      Shop High Purity Factory Price Tirzepatide Peptides for Lose Weight Tirzepatide-Detailed Image 1 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 3 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 4 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 5


       

        Company Profile  

       


      Shanghai Biotechnology Co., Ltd. was established in 2019. It mainly deals in peptide products, synthetic peptide amino acids, beauty and slimming products, and beauty freckle removal cosmetic raw materials. It has strong R&D capabilities, superb synthesis technology, and advanced quality control methods. It effectively promotes joint ventures with major companies and manufacturers, and serves the society and users with the concept of industrial development. It always adheres to market demand-oriented, continuously synthesizing new high-tech freckle and wrinkle removal beauty peptide products, which are mainly exported to the United States, Europe, South Africa, Nigeria and other countries and regions. It has rich export experience and ensures transportation safety. Shop High Purity Factory Price Tirzepatide Peptides for Lose Weight Tirzepatide-Detailed Image 6 Shop High Purity Factory Price Tirzepatide Peptides for Lose Weight Tirzepatide-Detailed Image 7 Shop High Purity Factory Price Tirzepatide Peptides for Lose Weight Tirzepatide-Detailed Image 8 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 9


       

        Shipping & Delivery

       


      Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 10 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss Peptide-Detailed Image 11


       

        Certifications  

       


      Shop High Purity Factory Price Tirzepatide Peptides for Lose Weight Tirzepatide-Detailed Image 11


       

        FAQ  

       


      Is tirzepatide available for weight loss?

      It's also FDA approved for chronic weight management in adults with or without diabetes. Along with diet and exercise, tirzepatide can lead to significant weight loss — an average of 15% to 20% (34 lbs to 48 lbs). But tirzepatide for weight loss is only recommended for people who meet certain BMI criteria.

      How fast do you lose weight on tirzepatide?

      How quickly you lose weight depends on factors like lifestyle habits, diet, activity level, age, and other medications you may be taking. However, most people who follow a healthy diet and exercise routine begin reporting some weight loss within a month to two months of starting the medication.

      Which payment is available for your company?

      Bank Transfer,Paypal or Bitcoins usdt trc usdt erc and so on.  You can choose the way which is convenient for you.

      May I get one sample before placing order?

      Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.Mutual effort towards each other.

      Why should you buy from us not from other suppliers?

      1. Powerful R & D team
      2. The ability of quantized production from grams to tons;
      3. Various kinds of advanced equipment in the laboratory and plant;
      4 .Strict QC standard to meet the demand of customers, advanced equipment for analysis and assay;
      5. Efficient and safe logistic plans for chemical products transportation;
      6 .Excellent after-sale service.
      7. Highest quality and good package
      8 .ISO certificate

      Shop High Purity Factory Price Tirzepatide Peptides for Lose Weight Tirzepatide-Detailed Image 12

      Send your message to us

      Our contact information: +852 47317681

      Email:sales02@tjszc.com









    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

    Location:

    Room 314A, Block A, Tianjin Youth Entrepreneurship Park, No. 85 Qingnian Road, Hongqiao District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    20

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    101-200

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.