Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Cathelicidin LL-37 hCAP-18 Fragment Peptide
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - large image1
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - image1
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - image2
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - image3
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - image4
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - image5
Cathelicidin LL-37 hCAP-18 Fragment Peptide buy - image6

Cathelicidin LL-37 hCAP-18 Fragment Peptide

ISO TDS 1 Inquiries

Unit Price:

$100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Laboratory Grade

Content:

99%

Port:

Shenzhen

Brand:

l'q

Packaging:

5mg

Price valid (until):

2026-08-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Items Specifications
    Product Name Cathelicidin LL-37 hCAP-18 Fragment Peptide
    CAS No. 154947-66-7
    Appearance White loose lyophilized powder, no visible foreign impurities
    Purity (HPLC) ≥99.0%
    Molecular Weight 4493.4 Da
    Amino Acid Sequence [LL-37, 37 aa]
    Water Content ≤5.0%
    Endotoxin Level <1 EU/mg
    Solubility Soluble in pure water, PBS buffer solution
    Storage Condition Sealed, protected from light, stored at -20℃
    Application Scope For in vitro laboratory immunology & microbiology research only

    Product Overview

    cathelicidin LL-37 hCAP-18 Fragment Peptide is a synthetic cationic short peptide composed of 37 amino acid residues, which is the only cathelicidin family active peptide derived from human body.his product is manufactured via solid-phase peptide synthesis technology, purified by high performance liquid chromatography (HPLC), with strict quality control system throughout the whole production process to guarantee stable batch-to-batch consistency.his product is manufactured via solid-phase peptide synthesis technology, purified by high performance liquid chromatography (HPLC), with strict quality control system throughout the whole production process to guarantee stable batch-to-batch consistency.

    Quality Standard Index

    High purity grade reduces interference of miscellaneous peptide impurities on experimental data, effectively improving the repeatability and accuracy of cell incubation and microbial inhibition in vitro testsow moisture content effectively avoids peptide chain hydrolysis and degradation during long-term sealed storage, extending the valid shelf life of lyophilized powder.

    Product Characteristics & Advantages 

    We adopt fully automated solid-phase peptide synthesis equipment for chain assembly, and use multi-step gradient elution HPLC purification to remove truncated peptide fragments, deprotection by-products and other interfering impurities.We adopt fully automated solid-phase peptide synthesis equipment for chain assembly, and use multi-step gradient elution HPLC purification to remove truncated peptide fragments, deprotection by-products and other interfering impurities.Each batch of finished products will be matched with independent HPLC chromatogram and mass spectrometry identification report to verify molecular weight and purity data one by one.All production workshops adopt 100,000-grade clean purification environment, all experimental contacting raw materials are endotoxin-free grade, and multiple endotoxin removal filtration steps are added in the post-treatment stage to meet the strict requirements of immunology cell research.Sealed lyophilized powder stored at -20℃ away from light can maintain stable chemical properties for 24 months, no obvious purity decline or peptide degradation phenomenon occurs within the validity period.

    Optional Packaging Specifications 

    ll inner packaging containers are made of low adsorption borosilicate glass and food-grade sealed aluminum foil, which will not adsorb peptide powder and cause sample loss.Outer transport package adopts shockproof foam box paired with ice packs for cold chain transportation to avoid high temperature affecting peptide activity during transit.

    Storage & Handling Requirements

    Long-term storage: Sealed glass vial or aluminum foil bag, stored at -20℃, protected from light and moisture, avoid repeated freeze-thaw cycles.hort-term temporary storage after opening: Sealed tightly at 2–8℃, finish experimental use within 30 days, prevent moisture absorption and impurity contamination.issolution operation suggestion: Use sterile ultrapure water or pH7.2 PBS buffer for dissolution, prepare fresh peptide solution before each experiment, discard unused residual liquid after single use, do not store diluted peptide solution for long time.ransportation condition: Whole cold chain low temperature transportation, avoid direct sunlight and high temperature environment exposure.

    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 1
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 2
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 3
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 4
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 5
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 6
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 7
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 8
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 9
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 10
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 11
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 12
    Shop Cathelicidin LL-37 hCAP-18 Fragment Peptide-Detailed Image 13

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Plot 1, No. 205 Tongbao Road, Jiangdong Subdistrict, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.