Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - large image1
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - image1
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - image2
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - image3
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - image4
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - image5
Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory buy - image6

Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory

1 Inquiries

Unit Price:

$76/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Brand:

Fire

Packaging:

10vials/box

Price valid (until):

2026-10-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,Skincare

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WA: +852 70911333  Email: ogunjitakusaz@outlook.com

     

    Our Core Peptide Offerings and Premium Freeze-Dried Powder

    At our company, we take pride in offering a diverse portfolio of peptide-based products designed to meet the varied needs of our customers. Our range includes innovative solutions for beauty enhancement, weight management, tanning, and more, all developed through the latest scientific research. We are committed to translating cutting-edge discoveries into highly effective, safe, and reliable peptide products, providing exceptional value to our clients.

    Beauty Peptides

    Our beauty peptides are among our flagship offerings, renowned for their safety and effectiveness. They work by stimulating collagen production, enhancing skin elasticity, and reducing fine lines and wrinkles. These peptides promote a smoother, more delicate complexion and possess antioxidant and anti-inflammatory properties, helping to defend against environmental damage and delay the aging process. Their efficient and safe characteristics have made them a favorite among consumers seeking youthful, radiant skin.

    Weight Loss Peptides

    Our weight management peptides are designed to support healthy and sustainable weight loss. They function by boosting metabolism, suppressing appetite, and facilitating fat breakdown. Importantly, these peptides help reduce body fat while preserving muscle mass, thereby preventing issues like skin sagging during weight loss. They are an ideal choice for individuals pursuing a healthy lifestyle and improved physical appearance.

    Tanning Peptides

    Our tanning peptides stimulate melanin production, enabling users to achieve a natural, healthy tan. By activating skin melanocytes, these peptides gradually darken the skin while also providing some degree of sun protection, reducing the risk of UV damage. They are simple to apply, effective, and serve as an excellent alternative for those seeking a safe, natural-looking tan without excessive sun exposure.

    Unparalleled Freeze-Dried Powder Technology

    In addition to our peptide products, we offer a premium freeze-dried powder that stands out for its comprehensive advantages in quality, performance, and value. We firmly believe that this lyophilized powder is a superior solution for various applications, thanks to its innovative preservation method.

    Key Benefits:

     

    Ultra-Low Temperature Preservation: The powder is stored at -196 ° C, causing the active components to enter a dormant state, which preserves their integrity and potency over time.

     

    This freeze-dried powder is ideal for customers seeking high-quality, stable, and easy-to-use peptide . We offer a wide selection of peptide products, all of which are crafted to meet strict quality standards. Our competitive pricing ensures that clients receive the best value for their investment.

    Customer Satisfaction and Support

    Our commitment to excellence is reflected in the positive feedback from our clients, many of whom have expressed satisfaction with the quality, efficacy, and reliability of our peptides and freeze-dried powders. We are always available to answer questions, provide guidance, and help our clients leverage our products to achieve their business goals.

    If you are interested in learning more about our products or exploring how they can add value to your operations, please do not hesitate to contact us. We look forward to partnering with you to support your success and help you stay ahead in this rapidly evolving industry.

    Company Profile

     

    Overview:  

    We specialize in high-purity peptide products, with each batch produced on dedicated production lines to ensure purity levels exceeding 99%. Our commitment to quality and innovation makes us a trusted partner in the global research, pharmaceutical, and healthcare industries.

     

    Quality Assurance:  

    All our products undergo rigorous testing and quality control under strict management systems. We provide comprehensive documentation including Certificates of Analysis to verify purity, potency, and compliance with international standards, ensuring reliability and transparency for our clients.

     

    Global Reach and Service:  

    With extensive experience and a wide-reaching logistics network, we offer door-to-door delivery and customs clearance assistance for clients worldwide, including the USA, Canada, Australia, Europe, and many other regions. Our dedicated customer service team is committed to providing prompt, responsive support.

     

    Core Values:  

    - Integrity: We operate honestly and transparently, earning the trust of customers, partners, and society.  

    - Quality First: We prioritize safety, effectiveness, and exceeding customer expectations in every product we deliver.  

    - Collaborative Growth: We foster open cooperation with research institutions, universities, and industry partners to create shared value and mutual success.  

    - Innovation and Learning: We continuously explore new scientific frontiers, improve our technologies, and encourage ongoing employee development to stay at the forefront of biotechnology.

     

    Mission:  

    To advance scientific research and healthcare innovation worldwide by providing premium-quality peptides, supporting the development of healthier lives and a brighter future.

     

    FAQ

    1 What types of peptides do you manufacture?

    We specialize in a variety of high-purity peptides, including custom peptides, research-grade peptides, cosmetic peptides, and peptide lyophilized powders and raw materials for pharmaceutical applications.

    2 What is the typical purity of your peptides?

    Our peptides are typically 99% pure, and we provide detailed COA (Certificate of Analysis).

    3 What if I need technical support after purchasing?

    Our technical and sales support team are always here to answer any questions you may have before or after your purchase. Please contact us via WhatsApp or email or form, we will usually respond within 12 hours.

    4 Do you ship internationally?

    Yes, we ship to over 35 countries and regions worldwide and provide full order tracking. If you have special shipping requirements, please let us know in advance.

    5 What payment methods do you accept?

    We support multiple secure payment methods, including: BTC/ETH/USDT/USDC/Alipay/etc.

    6 How long does it take to process and ship my order?

    Standard peptides: We will send out the goods within three days after receiving your payment, and the estimated delivery time is 5~15  days.

     

     

    Item

    Specifications

    MOQ

    1box

    Package

    Box

    Port

    HK

     

    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 1
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 2
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 3
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 4
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 5
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 6
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 7
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 8
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 9
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 10
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 11
    Shop Pharmaceutical Grade LL-37 Peptide Powder CAS 154947-66-7 | 99% High Purity, Wholesale, Customizable from Factory-Detailed Image 12

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,Skincare

    Location:

    Room 801, T095, No. 169 Haibin Road, Nansha Street, Nansha District, Guangzhou City

    Average lead Time:

    365

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.