Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 | 99% Purity | US Warehouse | Cosmetic Peptides | 5mg 10mg Vials | Lyophilized Powder
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 | 99% Purity | US Warehouse | Cosmetic Peptides  | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | 99% Purity | US Warehouse | Cosmetic Peptides | 5mg 10mg Vials | Lyophilized Powder

TDS 1 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

HK

Brand:

XINHONG

Packaging:

10mg*10vials

Price valid (until):

2026-10-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact Information


    RFQ quote is full, can't bid here. Contact me directly!!!

    Name:Annie

    Whatsapp:+852 5496 2030

    Email:xinhong4@zj-xinhong.com


    LL37    


    Items Specifications
     LL37 10mg*10vials

    1.Product Application

    Peptide products offer diverse functional benefits across multiple scenarios:
    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 
    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 
    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    2. Product Characteristics

    Appearance: Uniform white loose freeze-dried powder, agglomerate-free, pure color without visible impurities.
    High biological activity: Low-temperature lyophilization avoids peptide molecular denaturation, fully retains the combined activity of anti-inflammation, tissue repair and antioxidant from four peptide ingredients.
    Excellent solubility: Rapidly dissolves in distilled water and PBS buffer to form clear transparent aqueous solution with no precipitate.
    Stable storage performance: Sealed vials can be stored for 24 months under -20℃, light-free and dry environment.
    Sterile filling: Manufactured in Class 100,000 dust-free purification workshop, effectively minimizing foreign particle impurities and microbial contamination.

    3. Strict Quality Control Standards


    All LL37 Blend compound peptide raw materials conform to international laboratory research reagent standards.
    Each batch undergoes full HPLC purity test, MS molecular weight identification, heavy metal detection, endotoxin assay and sterility inspection.
    Official batch COA test report and TDS technical data sheet can be provided for every shipment.
    We support customers’ third-party laboratory re-inspection, and our products meet EU REACH SVHC hazardous substance control regulations.
    The entire production process follows standardized peptide quality control procedures, with complete production records for full traceability of each batch.

    4. Packaging & Usage Scenes

    Packaging Introduction

    Inner packing: 10mg sterile glass vial with rubber stopper and aluminum crimp cap; each vial is individually packed in moisture-proof aluminum foil bag to isolate moisture and oxygen.

    Outer packing: Shock-resistant foam liner + standard export carton, suitable for long-distance international logistics and low-temperature cold chain transportation. Custom labels and bulk packaging solutions are available upon request.

    Applicable Scenarios

    Mitochondrial metabolism research laboratories

    University anti-aging & cell biology research labs

    Biomedical metabolic regulation research institutions

    Anti-aging skincare raw material R&D enterprises

    Independent muscle health and cell experiment laboratories

    5. Factory Advantages

    Direct LL37 Chinese peptide manufacturer with independent peptide synthesis and freeze-drying production workshops, stable continuous stock supply of Epithalon.
    Flexible order quantity: Small sample trial orders and large bulk wholesale orders are both acceptable.
    Full set of supporting documents: COA, TDS, REACH SVHC test reports can be supplied as required.
    Professional technical team offers one-stop guidance on storage, dilution ratio and experimental/cosmetic formula matching.
    Factory direct competitive price, exclusive volume discount for long-term global cooperative partners.

    6. Purchase Tips

    We offer special limited preferential prices for new stable long-term partners. If you have any demand for LL37 Blend 10mg lyophilized peptide powder, please contact our sales team to get the best quotation. All customer inquiries will receive efficient replies within working hours.


    Shop PT41 10mg Research Grade Synthetic Peptide-Detailed Image 1 Shop MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c) Peptide-Detailed Image 2 Shop MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c) Peptide-Detailed Image 3 Shop GHK-Cu High Purity Copper Peptide Lyophilized Powder  50mg Vial-Detailed Image 2   Shop High Purity Retatrutide 10mg Pharmaceutical Grade Peptide Freeze-Dried Powder-Detailed Image 5  Shop High Purity Retatrutide 10mg Pharmaceutical Grade Peptide Freeze-Dried Powder-Detailed Image 7 Shop High Purity Retatrutide 10mg Pharmaceutical Grade Peptide Freeze-Dried Powder-Detailed Image 8  Shop High Purity Retatrutide 10mg Pharmaceutical Grade Peptide Freeze-Dried Powder-Detailed Image 10  Shop High Purity Retatrutide 10mg Pharmaceutical Grade Peptide Freeze-Dried Powder-Detailed Image 12 Shop MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c) Peptide-Detailed Image 10 Shop MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c) Peptide-Detailed Image 11 Shop MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c) Peptide-Detailed Image 12

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

    Location:

    Block 1, No. 205, Tongbao Road, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province (within Zhejiang Juzhiyun Holding Co., Ltd., on the 4th floor of 2 buildings)

    Payment Terms:

    TT against copy of documents,O/A,100% TT in advance

    Total Employees:

    101-200

    Year of Establishment:

    2026

    Company Profile

    Yiwu Xinhong Trading Co., Ltd. is a professional trading company engaged in the international supply and distribution of peptides, chemical raw materials.
    Leveraging a reliable network of qualified manufacturers and strategic partners, we provide customers with high-quality products, competitive pricing, and efficient supply chain solutions. Our products are widely used in pharmaceutical research, biotechnology, chemical manufacturing, laboratory research, and various industrial applications.

    With extensive experience in international trade, we are committed to helping customers source quality chemical products from China through professional procurement services, strict supplier selection, and reliable logistics support. We focus on building long-term partnerships by delivering consistent quality, responsive communication, and dependable service.

    Main Products
    Peptides
    Chemical Raw Materials
    Organic Chemicals
    Inorganic Chemicals
    Fine Chemicals
    Our Advantages
    Professional international trading services
    Reliable supplier network
    Competitive pricing and flexible sourcing
    Strict quality control and supplier management
    Fast response and efficient communication
    Global export and logistics support
    Business Scope

    Global sourcing, international trade, import and export of chemical products, customized procurement solutions, and supply chain services.

    Markets

    Europe, North America, South America, Southeast Asia, the Middle East, and other international markets.

    Yiwu Xinhong Trading Co., Ltd. is committed to providing professional chemical sourcing solutions and creating long-term value for customers worldwide. We look forward to establishing mutually beneficial partnerships with clients across the globe.

    Business Type: Trading Company
    Company Name: Yiwu Xinhong Trading Co., Ltd.
    Main Business: Peptides, Chemical Raw Materials
    Market: Global

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.