Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > 375 Fast delivery, large quantity discounts, high quality
375  Fast delivery, large quantity discounts, high quality buy - large image1
375  Fast delivery, large quantity discounts, high quality buy - image1
375  Fast delivery, large quantity discounts, high quality buy - image2
375  Fast delivery, large quantity discounts, high quality buy - image3
375  Fast delivery, large quantity discounts, high quality buy - image4
375  Fast delivery, large quantity discounts, high quality buy - image5
375  Fast delivery, large quantity discounts, high quality buy - image6

375 Fast delivery, large quantity discounts, high quality

TDS 3 Inquiries

Unit Price:

$1-1.3/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHENZHEN

Brand:

customization

Packaging:

10 pieces per box

Price valid (until):

2026-10-17

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    WhatsApp:85265574617 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 1 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 2 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 3 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 4 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 5 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 6 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 7 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 8 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 9 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 10   


    I. Direct Broad-Spectrum Antimicrobial (Core Function)
    1. Anti-Bacterial (Effective against both Gram-negative and Gram-positive bacteria, including drug-resistant strains)
    - Gram-negative: Escherichia coli, Pseudomonas aeruginosa, Acinetobacter baumannii; neutralize LPS (endotoxin), inhibit sepsis inflammatory storm
    - Gram-positive: Staphylococcus aureus (including MRSA resistant strains), Streptococcus, Streptococcus pneumoniae
    - Additional capabilities: Dissolve bacterial biofilms, promote neutrophil release of NET to capture and kill bacteria
    2. Anti-Fungal
    Candida albicans, Aspergillus; damage fungal cell membranes, disrupt calcium homeostasis, induce mitochondrial oxidative stress, inhibit fungal hypha formation.
    3. Anti-Viral
    Enveloped viruses: Influenza, HIV, COVID-19, Herpes virus; directly destroy viral envelope, block virus attachment to host cells.
    4. Anti-Parasitic
    Inhibit the proliferation of Toxoplasma gondii and Leishmania.
    II. Neutralizing endotoxins and inhibiting excessive inflammation (anti-inflammatory protection)
    The LPS released by bacterial death can trigger severe inflammation and shock.
    1. LL-37 binds to LPS, preventing LPS from activating the TLR4 pathway and reducing the release of pro-inflammatory factors such as TNF-α and IL-6;
    2. Alleviating sepsis, pulmonary infections, and uncontrolled inflammation in skin wounds;
    3. Bidirectional regulation of inflammation: low concentration promotes immune activation, high concentration inhibits excessive inflammation, avoiding tissue damage.
    III. Immune Regulation (Chemotaxis + Activation of Immune Cells)
    1. Recruiting immune cells through chemotaxis: As chemotactic factors, they attract neutrophils, macrophages, dendritic cells, and T cells to the infected area;
    2. Activating macrophages to phagocytose and eliminate pathogens, enhancing antigen presentation;
    3. Stimulating epithelial and immune cells to secrete cytokines, coordinating innate immunity and adaptive immunity;
    4. Stabilizing the extracellular trapping network (NET) of neutrophils, preventing bacterial nucleases from degrading NET and continuously capturing pathogens.
    IV. Tissue Repair and Wound Healing (Skin/Mucous Membrane Focus)
    1. Activate EGFR (epidermal growth factor receptor), promoting the migration and proliferation of keratinocytes and epithelial cells, accelerating the repair of skin, intestinal tract, and respiratory tract mucous membranes;
    2. Promote angiogenesis (stimulate endothelial cell proliferation), improving blood supply to the wound site;
    3. Reduce scar formation at the wound site, maintaining the integrity of the mucous membrane barrier;
    4. Protect the intestinal epithelial barrier in the intestine, reduce bacterial translocation, and maintain intestinal homeostasis.
    V. Anti-tumor
    Protective effect
    - Directly kills some tumor cells (lung cancer, liver cancer, colorectal cancer cells), damages the tumor cell membrane;
    - Inhibits tumor proliferation, invasion and metastasis, angiogenesis;
    - Activates the body's anti-tumor immunity, enhances the killing ability of immune cells against tumors.
    Carcinogenic risk (high concentration / chronic inflammatory environment)
    Chronic inflammation with high LL-37 concentration can promote the proliferation of some tumors, and has a dual effect in ulcerative colitis-related colorectal cancer and cutaneous squamous cell carcinoma.
    VI. Participating in skin barrier and mucosal homeostasis
    1. Skin: Secreted by sebaceous glands and keratinocytes, resisting skin microbiota, Propionibacterium acnes; Insufficient LL-37 is prone to atopic dermatitis and psoriasis;
    2. Respiratory tract: Secreted by airway epithelium, preventing pneumonia and sinusitis;
    3. Intestine: Secreted by intestinal crypts, balancing intestinal microbiota, reducing the risk of inflammatory bowel disease.

    Items Specifications
    Product Name 375
    Purity 99.9%
    Storage Condition Seal and store in cool dry place


      Company Profile 


    Hong Kong Biopetide Research Limited is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. The company boasts advanced laboratories and a rigorous quality control system, with its products having obtained multiple international certifications, ensuring safety and efficacy.
    Its customers are spread across Europe, the United States, Southeast Asia, the Middle East, and other regions.
    Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. With advanced laboratories and a rigorous quality control system, our products have obtained international certification, ensuring safety and efficacy.
    As a global trading company, we provide customized solutions to customers across Europe, the United States, Southeast Asia, the Middle East, and many other regions. Upholding the philosophy of "technology leading health," we are committed to innovation, striving to deliver high-quality health products to consumers worldwide. Our business principles focus on establishing a strong domestic market presence, increasing R&D investment, manufacturing premium products, and leveraging technology to promote environmental protection and sustainable development. At the same time, we actively expand into international markets, serve society with sincerity, and aim to become a modern, eco-friendly, and technologically advanced enterprise that meets global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to building stable, strategic, and long-term partnerships with suppliers and customers both domestically and internationally, working together to create a brighter future.


      Common Problem  


    1. We are the source factory of raw materials, offering high-quality and high-purity raw materials at wholesale prices.
    2. We can provide global delivery services and have an exclusive delivery team to ensure safety and speed.
    3. You can contact us to inquire about any products. Our product range is extensive and we support customization to meet your needs as much as possible.
    4. We support various payment methods and all details can be negotiated.
    5. If you have any questions, please feel free to contact me. I will do my best to answer your questions for you.
    6. Firstly, we guarantee the quality of the products; secondly, we guarantee the efficiency of transportation and the clearance rate; thirdly, we will provide you with the best service in all aspects.

    You get what you pay for. If you have any questions, I will answer them all.


      Mode of transportation  


    We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure timely shipment, quick delivery, stable logistics tracking, and safe and punctual delivery.

    Shop Lemon bottle High quality, in stock, fast delivery-Detailed Image 9 Shop FM2 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 12

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • 375  Fast delivery, large quantity discounts, high quality Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.