Product
Supplier
Encyclopedia
Inquiry
Home > Organic Chemistry > Nitrogen Compounds > LL-37 for Sale > CP10 LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - large image1
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - image1
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - image2
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - image3
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - image4
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - image5
CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate buy - image6

CP10 LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate

TDS 3 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2045-07-13

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Anne
    WhatsApp: +852 6462 7346

    Shop CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate-Detailed Image 1

    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop CBL60 5AD SMO5 SMO10 KS5 CAS12656-61-0 Peptide drugs-Detailed Image 2

    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop SK5 SK10 TSM5 TSM10 XT100 CAS129954-34-3 Safe delivery of personalized peptides-Detailed Image 3

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate-Detailed Image 4

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop XA10 SK5 SK10 TSM5 TSM10 CAS129954-34-3 with convenient transportation-Detailed Image 5
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    Shop CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate-Detailed Image 6
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Shop LC600 CBL60 5AD SMO5 SMO10 CAS12656-61-0 The price is the factory price-Detailed Image 7
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.
    Shop CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate-Detailed Image 8

    Oral peptides can regulate the body's condition, repair internal cells, improve sleep quality, regulate basal metabolism, and help maintain energy; topical skin care peptides can soothe fine lines, firm the skin texture, and repair the damaged skin barrier.
    This product is gentle in composition and suitable for most skin types, differentiating it from ordinary health supplements. By taking it in appropriate amounts on a daily basis, it can improve one's complexion from within and delay signs of aging. The peptides are absorbed quickly and cause little burden on the stomach and intestines. Whether for daily maintenance or for people who stay up late or have irregular sleep schedules, it is suitable as a long-term maintenance option to achieve a state improvement from the inside out.



    Shop CBL60 5AD SMO5 SMO10 KS5 CAS12656-61-0 Peptide drugs-Detailed Image 9

    Shop G25 G65 G610 wu AP5 CAS129954-34-3 High-quality peptide-based drugs-Detailed Image 10
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • CP10  LC120 LC216 LC526 LC600 CAS154947-66-7 price moderate Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Nitrogen Compounds

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.