CND10(CJC NO DAC) | 154947-66-7 | CN Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials | Lyophilized Powder
TDS 3 Inquiries
154947-66-7
High Purity Grade
99%
Shenzhen
Tong Peptides
5mg/vial, 10 vials/box
Yes
2026-09-13
retatrutide,TB-500,GHK-CU,peptide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceLL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.Research & Reference Note
CND10(CJC NO DAC) | 154947-66-7 | CN Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
CertificatesBasic Info-
Product Name:
LL-37
Other Name:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS No.:154947-66-7
Molecular Formula:C205H340N60O53
InChIKeys:POIUWJQBRNEFGX-XAMSXPGMSA-N
Molecular Weight:0
EC Number:211-519-9
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
-
-
Seller Information
-
Business Type:
Manufactory
-
Main Products:
retatrutide,TB-500,GHK-CU,peptide
-
Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing
-
Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance
-
Total Annual Revenue:
$10 million-$25 million
-
Total Employees:
501-1000
-
Year of Establishment:
2023
-
-
Inquiry History3 Inquiries
Country Product Purchase Quantity Date Posted
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL-37
5 MG Jun 23, 2026 Post an enquiry for this product
- Hot Searches
- where do i get reta
- draw the structure of 3 4-dimethyl-1-pentene
- nylon 65
- ammonia water
- cetilistat buy
- ammonium sulphate crystalline
- crysin
- tirzepatide peptide for sale
- benzalkonium chloride sds
- retatrutide peptide buy usa price
- perfume ingredients supplier
- best research chemical website
More from this Seller
-
-
-
HX2|Factory Direct Supply|>99% High Purity and Quality Peptide|Fast and Safe Shipping|Door-to-Door Delivery Service|Customs Clearance and Insurance
Pharmaceutical Grade / 99%
$2/UNIT FOB
-
-
-
-
Tong Peptides High-Quality SMO5 | 99% Purity | Fast Delivery | Door-to-Door Service | In Stock
Pharmaceutical Grade / 99%
$80/MT FOB
-
-
-
-
B12|Factory Directly Supply|>99% High Purity |Fast and Safe Shipping|On Time Arrival|Customs Clearance and Insurance
Pharmaceutical Grade / 99%
$2/UNIT FOB
-
-
-
-
NP810 High-quality peptides,white powder,provide home delivery service-available in stock
Pharmaceutical Grade / 99%
$16-18/MT FOB
-
-
-
-
SMO5|Factory Direct Supply|>99% High Purity and Quality Peptide|Fast and Safe Shipping|Door-to-Door Delivery Service|Customs Clearance and Insurance
Pharmaceutical Grade / 99%
$2/UNIT FOB
-
-
-
-
Tong Peptide BBG70 Factory direct sales Low price High Quality Fast Delivery and Great Prices GLOW,,
Pharmaceutical Grade / 99%
$2/MT FOB
-
