 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > SM5 Semaglutide| TongPeptides | 99% Purity |

SM5 Semaglutide| TongPeptides | 99% Purity | buy - large image1

SM5 Semaglutide| TongPeptides | 99% Purity | buy - image1

SM5 Semaglutide| TongPeptides | 99% Purity | buy - image2

SM5 Semaglutide| TongPeptides | 99% Purity | buy - image3

SM5 Semaglutide| TongPeptides | 99% Purity | buy - image4

SM5 Semaglutide| TongPeptides | 99% Purity |

Name: SM5 Semaglutide| TongPeptides | 99% Purity |
Brand: Tongpeptide
SKU: pr2608251107
Price: 4 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$4/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-25

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Semaglutide is a structurally modified synthetic peptide classified as GLP‑1 receptor agonist, serving as a vital research molecule for metabolic‑related studies. Native GLP‑1 is rapidly degraded by enzymes with short effective duration. Modified with fatty‑acid chain, Semaglutide achieves better anti‑enzymatic stability and longer functional duration in pre‑clinical models, supporting diverse mechanism‑exploration experiments.

In research models, Semaglutide targets and binds to GLP‑1 receptors to modulate multiple metabolic signaling pathways. It acts on islet‑related cells to participate in glucose‑dependent signal regulation, influences signals linked to energy intake and modulates whole‑body metabolic homeostasis. Pre‑clinical experimental data show that this molecule can regulate appetite‑associated signals to affect feeding behavior and energy intake, as well as modulate markers related to glucose metabolism. It is a classic experimental material for glucose and lipid metabolism research.

Numerous pre‑clinical cell and animal model studies adopt Semaglutide for research on metabolic homeostasis, islet cell function and energy regulation. It is widely used in in‑vitro cell assays and controlled animal‑model studies, providing stable and reliable reagent options for metabolic biology and endocrinology research projects.

Provided as lyophilized powder. HPLC‑purified with high purity and stable physicochemical properties, suitable for lab cold‑storage, reconstitution and grouped control experiments. For laboratory‑research only. Not a pharmaceutical product. Prohibited for human or animal treatment, injection or oral administration. No therapeutic effects.

Shipping Method Shop KPV5KPV10-Detailed Image 3

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items	Specifications
SM5	5mg* 10vials

Shop KPV5KPV10-Detailed Image 20

Classification of the substance or mixture

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Research

Class:

GLP-1R agonist

Status:

FDA-approved (Ozempic / Wegovy / Rybelsus)

Mechanism:

Long-acting, selective glucagon-like peptide-1 (GLP-1) receptor agonist with 94% sequence homology to human GLP-1. Engineered for extended half-life (~1 week) via albumin binding (fatty acid acylation at Lys26) and resistance to DPP-4 degradation (Aib substitution at position 8). Promotes insulin secretion, inhibits glucagon release, delays gastric emptying, and reduces appetite via central nervous system GLP-1R activation.

Activity note:

Potent, selective GLP-1R agonist. Reported binding affinity Ki = 0.38 ± 0.06 nM. Semaglutide is a human GLP-1 analog with structural modifications for albumin binding (C18 fatty diacid at Lys26) and enzymatic stability (Aib8 substitution).

Source:

Lau J, et al. J Med Chem. 2015;58(18):7370-7380. Wilding JPH, et al. N Engl J Med. 2021;384(11):989-1002.DOI

Clinical Development:

NCT03548935; NCT03552757; NCT01720446; NCT02692716

FDA:

Ozempic, Wegovy, Rybelsus (approved 2017-12-05)

References

ChEMBL:

DrugBank:

KEGG DRUG:

PubChem:

Literature:

NEJM: Wilding et al. (2021) — STEP-1; NEJM: Marso et al. (2016) — SUSTAIN-6; J Med Chem: Lau et al. (2015) — Discovery of Semaglutide; FDA: Ozempic (NDA 209637)

Disclaimer:

Semaglutide is approved as a prescription medicine (Ozempic, Wegovy, Rybelsus) in certain jurisdictions. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Fair price cagrilin 2.5mg+Samaglutide2.5mg cagrilin 5mg+Samaglutide5mg CBL60 CD5 CGL10 CGL5 CJC- NO DAC 5mg + IPA5mg	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
LL37/ 99% Purity/ 5mg 375/	Pharmaceutical Grade/99	$78/UNIT FOB	HUATAI PEPTIDES	Inquiry
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price	Pharmaceutical Grade/99	$12-13/BOU FOB	Hangzhou Zhongshuan Technology Co., Ltd.	Inquiry
LL37 Fast delivery High purity Weight loss peptide Safe transportation	Pharmaceutical Grade/99	$20-25/G FOB	Shanxi Andashihai Technology Co., Ltd.	Inquiry
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide	Pharmaceutical Grade/99	$10/MT FOB	Jinan Pingxing Trading Co., Ltd.	Inquiry

SM5 Semaglutide| TongPeptides | 99% Purity |

Product Description

Seller Information

Inquiry History

Classification of the substance or mixture

GHS label elements, including precautionary statements

Other hazards which do not result in classification

More Choices Find All Products for Sale 

Related Searches

More from this Seller