Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | China Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - large image1
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - image1
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - image2
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - image3
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - image4
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - image5
LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials buy - image6

LL37 | China Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials

TDS 3 Inquiries

Unit Price:

$47-50/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

TongPeptide

Packaging:

10mg *10vials*1 box

Price valid (until):

2026-12-31

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 1


    Product advantages and features


    1 . Ultra high purity: detected by high-performance liquid chromatography (HPLC), with an overall purity of ≥ 99%, controllable impurities, and extremely high batch stability.
    2. Mature technology: The molecular structure is complete and the active structure is well preserved.
    3. Excellent solubility: Freeze dried powder is loose and delicate, dissolves quickly in water, and the solution is clear without precipitation,.
    4. Strong stability: Long storage period under low-temperature sealing conditions, not easy to decompose, and not easily affected by moisture.


    Shop P41 Factory price hot selling high purity with safe delivery-Detailed Image 2
    Shop Weight loss peptides Pure Cagrilintide raw powder Cagrilintide vials CAS 1415456-99-3 buy - image1Weight loss peptides Pure Cagrilintide raw powder-Detailed Image 3

    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 4


    Product packaging

    5mg/vial,10vials/box;

    10mg/vial,10vials/box;

    15mg/vial,10vials/box;

    20mg/vial,10vials/box;

    30mg/vial,10vials/box;

    60mg/vial,10vials/box;

    Shop MS10 High-quality peptides,white powder,provide home delivery service-available in stock in the warehouse-Detailed Image 6

    Shop Semaglutide Peptide Lyophilized Powder CAS 910463-68-2 High Purity Organic Reagent-Detailed Image 8

    Who we are

           TopTong Labs is positioned as a document-first lyophilized powder supply support brand. We help customers request product information, batch-related documents, shipping options, and private communication through a structured inquiry process.

            Our focus is not aggressive claims. Our focus is clear product presentation, document support, discreet handling, and practical communication for global customers.

    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 9

    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 10

    Why choose us  

     

              Our products are of reliable quality and sell well all over the world, with partners across many countries and regions. We have professional technical support and complete after-sales teams to promptly respond to all your inquiries and demands.


               We always strictly control product quality, adhere to honest business principles, and prioritize quality and service. With stable product strength and thoughtful services, we sincerely welcome global customers to negotiate cooperation and achieve win-win development together.

               We have been deeply engaged in the peptide industry for many years, serving as a source biotechnology factory integrating R&D, synthesis, production and sales.

              We strictly follow production and quality control standards, with the whole process adopting aseptic production and independent lyophilization and packaging. Our products feature stable appearance, good solubility and high activity retention.

              We support trial orders with small quantities, bulk orders and customized formulas, providing one-stop solutions for foreign trade supply and private customization needs.


    Shop MS10 High-quality peptides,white powder,provide home delivery service-available in stock in the warehouse-Detailed Image 10

    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 12


    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 13


    Logistics

    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 14


    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 15


    Shop Tirzepatide Peptide Powder CAS 2023788-19-2 High Purity Research Raw Material-Detailed Image 16

    Shop Weight loss peptides Pure Cagrilintide raw powder Cagrilintide vials CAS 1415456-99-3 buy - image1Weight loss peptides Pure Cagrilintide raw powder-Detailed Image 17

    Items Specifications
    Product Name LL37
    Purity ≥99%
    Storage Condition Store sealed at -20℃, dry and dark.
    Appearance  White powder
    Transportation By Air
    Origin China






      FAQ  

    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you.
    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and UPS express to you after receive your payment, it would take around 5-15 days to your address.
    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
    4. What's the payment methods ?
    We could accept pay through bank transfer and bitcoin.
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 | China Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL37 | China  Warehouse | Cosmetic Peptides | 99% Purity | 10mg Vials Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.