 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > VI20 | TongPeptides | 99.9% Purity |COA ,.

VI20 | TongPeptides | 99.9% Purity |COA ,. buy - large image1

VI20 | TongPeptides | 99.9% Purity |COA ,. buy - image1

VI20 | TongPeptides | 99.9% Purity |COA ,. buy - image2

VI20 | TongPeptides | 99.9% Purity |COA ,. buy - image3

VI20 | TongPeptides | 99.9% Purity |COA ,. buy - image4

VI20 | TongPeptides | 99.9% Purity |COA ,.

Name: VI20 | TongPeptides | 99.9% Purity |COA ,.
Brand: Tongpeptide
SKU: pr2609172454
Price: 4 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$4/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-10-17

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

VI20 is a premium high-purity synthetic bioactive peptide, professionally developed for standardized peptide application and functional optimization. Featuring a refined, stable amino acid sequence and excellent biocompatibility, this peptide stands out for its reliable, mild, and long-lasting biological activity. Compared with ordinary peptide products, VI20 delivers more balanced and stable functional performance, making it a high-quality option for daily peptide application and functional maintenance scenarios.

The core advantages of VI20 lie in its outstanding comprehensive regulatory effects on bodily microenvironment and cellular status. This bioactive peptide can effectively promote cellular vitality, optimize basic cellular metabolism, and support the normal repair and maintenance of cells and tissues. It works to balance internal oxidative status, relieve daily metabolic pressure, and help maintain a healthy and stable physiological state. With gentle and non-irritating activity, VI20 produces steady and sustainable improvement effects without abrupt physiological fluctuations, suitable for long-term regular application.

In terms of product performance, VI20 boasts superior water solubility and high biological absorption efficiency. It can rapidly exert its functional effects and maintain stable activity in conventional application environments, with no obvious efficacy attenuation during use. Manufactured via advanced standardized synthesis and strict purification processes, the product achieves ultra-high purity, stable molecular structure, and excellent batch consistency. Every batch of VI20 maintains uniform quality and stable efficacy, fully meeting consistent daily application needs.

VI20 is provided in lyophilized powder form, which perfectly locks in intrinsic bioactivity and greatly extends the service life of the product. Low-temperature sealed storage can effectively preserve its optimal activity and ensure stable efficacy for long-term use. It is strictly stated that VI20 is for laboratory research use only, not applicable for human clinical treatment, diagnosis, cosmetic injection or therapeutic purposes. All applications must comply with standard laboratory operation specifications and relevant regulations.

Shipping Method Shop KPV5KPV10-Detailed Image 3

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items	Specifications
VI20mg	20mg* 10vials

Shop KPV5KPV10-Detailed Image 20

Classification of the substance or mixture

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

VI20 | TongPeptides | 99.9% Purity |COA ,. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
NP810---=High purity, large quantity, discounted price. Direct delivery from the manufacturer.	Pharmaceutical Grade/99.9	$1-1.3/MT FOB	Hong Kong Biopetide Research Limited	Inquiry
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price	Pharmaceutical Grade/99	$12-13/BOU FOB	Hangzhou Zhongshuan Technology Co., Ltd.	Inquiry
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg	Pharmaceutical Grade/99	$50/MT FOB	Changsha Caoquan Biotechnology Co., Ltd.	Inquiry
LL37/ 99% Purity/ 5mg 375/	Pharmaceutical Grade/99	$78/UNIT FOB	HUATAI PEPTIDES	Inquiry
LL37 5 Excellent quality Safety Certified Professional-Grade Cost effective	Pharmaceutical Grade/99	$78-80/MT FOB	Ti.ZhenBo	Inquiry

VI20 | TongPeptides | 99.9% Purity |COA ,.

Product Description

Seller Information

Inquiry History

Classification of the substance or mixture

GHS label elements, including precautionary statements

Other hazards which do not result in classification

More Choices Find All Products for Sale 

Related Searches

More from this Seller