Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - large image1
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - image1
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - image2
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - image3
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - image4
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - image5
LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production buy - image6

LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production

3 Inquiries

Unit Price:

$104/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

ZM

Packaging:

5mg per vial; 10vials/box

Sample Available:

Yes

Price valid (until):

2027-09-01

Company Type:
Trader
Location:
China
Payment Terms:
TT against copy of documents,100% TT in advance
Average Lead Time:
1 days
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Product Details


     

    Sales Manager:Grace

    WhatsApp / WeChat:+8615533197069

    Email:Grace@hzzmtrade.com

    Items Specifications
    Pruduct Name LL-37
    CASNO 154947-66-7
    Petide Purity
    99%
    Apperance
    Lyophilized Power
    Peptide Specification 5mg
    Packaging Glass vials,10vials/box
    Storage Cool Dry Place
    MOQ 1 Box (10 vials)


    Manufacturer advantages


    1. 1.We support large‑scale production and offer customized solutions.
    2. 2.Bottle dimensions and milligram filling volumes can be adjusted to meet your requirements.
    3. 3.Safe and reliable shipping channels are available.
    4. 4.All vials go through vacuum‑sealing treatment.
    5. 5.Brand‑new fresh batches are produced every 6‑8 days.

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 1

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 2


    Product Advantages


    Quality Control: Our products are manufactured in GMP‑certified facilities with full‑process traceability, and supporting documents comply with relevant regulatory standards.

    Supply Capacity: A wide range of product specifications are available. We maintain stable lead times and flexible production capacity to adapt to different orders.

    Price Benefits: Direct factory‑sourced quotations with discounts for bulk purchases. A well‑functioning stable supply chain caters to diverse market order requirements.

    Support Services: Complete sets of documentation are provided, alongside professional technical guidance for formulations.

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 3

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 4


      Basic Introduction  


    LL-37 (hCAP-18) is an innovative human-derived cationic antimicrobial peptide. LL-37 is the only known member of the Cathelicidin family of antimicrobial peptides in humans, produced by cleavage of the C-terminus of hCAP-18, and possesses an amphipathic α-helical structure. It exerts broad-spectrum antimicrobial activity primarily by directly disrupting bacterial membrane structures, while also serving as a key regulator of innate immunity, participating in the modulation of inflammatory responses, chemotaxis of immune cells, and promotion of angiogenesis. Related studies have shown that LL-37 exhibits multiple activities in anti-biofilm formation, antiviral effects (such as Rift Valley fever virus and porcine epidemic diarrhea virus), and promotion of diabetic wound healing. In addition, it displays a complex dual role in tumor biology, potentially promoting proliferation in some tumors while also inhibiting the development of other tumor types.

    This product is typically stored and transported in lyophilized powder form. To maintain molecular activity and structural stability, it is recommended to store it at -20°C or lower. Prolonged exposure to high temperatures or room temperature environments should be strictly avoided to prevent activity decline.


     Functions


    Broad-Spectrum Antimicrobial and Biofilm Inhibition: LL-37 can directly disrupt bacterial membrane structures through electrostatic attraction, inhibiting biofilm formation of pathogens such as Pseudomonas aeruginosa at very low concentrations (0.5 μg/ml). Its mechanisms include reducing initial bacterial adhesion, downregulating biofilm-related genes, and interfering with quorum sensing systems, demonstrating research value against multidrug-resistant strains.

    Inflammatory response regulation: As a key regulator of innate immunity, LL‑37 suppresses the release of pro‑inflammatory cytokines triggered by LPS and multiple Toll‑like receptor agonists. Studies have confirmed that it acts via the MAP kinase pathway to reduce p38 activation, exhibiting prominent activity in maintaining inflammatory balance and combating sepsis.

    Wound Healing and Regeneration: Multiple studies have shown that LL-37 can promote keratinocyte migration, angiogenesis, and granulation tissue formation, accelerating diabetic wound healing. Its mechanisms involve activating the TFEB-dependent autophagy pathway and EGFR, PI3K/Akt signaling cascades, demonstrating clear application value in tissue regeneration research.

    Antiviral and Immune Delivery: LL-37 can serve as a transport carrier for the immunologically active molecule cGAMP, specifically binding to and delivering it to target cells, thereby activating the STING signaling pathway and enhancing interferon-mediated antiviral immune responses. This activity expands its application scenarios in host defense mechanism research.

    Dual Role in Tumor Biology: LL-37 exhibits complex tissue-specific effects in cancer research. In ovarian, lung, and breast cancers, it may promote tumor progression by stimulating proliferation, chemotaxis, and angiogenesis; whereas in gastric cancer, colon cancer, and hematological malignancies, it demonstrates tumor-suppressing activity. This dual characteristic makes it an important tool in cancer mechanism research.





     Applications

     


    As an advanced peptide raw material, LL-37 (CAS 154947-66-7) is widely used in core fields such as infection control research, immune regulation exploration, wound repair mechanism investigation, and tumor biology research. LL-37 is the only known member of the Cathelicidin family of antimicrobial peptides in humans, exerting broad-spectrum antimicrobial activity by directly disrupting bacterial membrane structures, while also being capable of dissolving biofilms and neutralizing endotoxins. It primarily participates in the tissue repair process by regulating inflammatory responses, chemotaxis of immune cells, and promoting angiogenesis and cell migration. This raw material is mainly applied in experimental research scenarios including multidrug-resistant bacterial infection studies, biofilm-related chronic infection exploration, diabetic wound healing mechanism investigation, inflammatory signaling pathway research, and tumor microenvironment regulation.


    Company Introduction  


    Our company focuses on the R&D and supply of various peptide products. Our main product line includes weight‑loss peptides, anti‑wrinkle peptides, tanning peptides and other peptide raw materials, and we also accept customized peptide product requests. The company has established a complete quality management system with strict quality‑control standards, supported by thoughtful one‑stop customer services. Our experienced team is ready to deliver professional support to fully meet diverse procurement requirements from global clients.

    We put customer value at the heart of our business. We stick to high‑product standards while maintaining competitive pricing. Flexible order quantities are supported, and we closely monitor production and lead times to ensure on‑time delivery for every order. Our products are mainly exported to key overseas markets including Europe, the United Kingdom, the United States, Canada and Australia. Thanks to consistent product quality and reliable service systems, we have gained wide recognition and trust from customers worldwide.

    We have built mature in‑house cross‑border distribution channels covering the United States, Canada, the United Kingdom, Spain, Poland, the Netherlands, Germany, Russia, Kazakhstan and other regions. Door‑to‑door one‑stop delivery is available with streamlined customs clearance, eliminating customs‑related issues and enabling hassle‑free receipt of goods for customers.

    Strict internal controls are implemented across the whole workflow, from raw‑material selection and production to logistics delivery. Only high‑purity, premium‑grade raw materials are adopted. Guided by the core philosophy of “survive by quality, grow by reputation”, we supervise every production procedure to guarantee stable product quality from the source.

    We possess distinctive product and service strengths: safe and efficient production technology balances consistent quality and fast turnaround. Sample testing services are offered prior to formal bulk orders for customers to verify product performance. With years of experience serving overseas markets, we provide cost‑effective goods together with comprehensive after‑sales support to resolve all kinds of cooperation‑related issues efficiently. We aim for full customer satisfaction and strive to build a trustworthy international brand.

    Going forward, we will keep focusing on the R&D and manufacturing of high‑quality products, optimize pricing structures, improve professional technical and commercial support, and build a highly efficient team. Upholding the principle of integrity and win‑win partnership, we will continuously upgrade after‑sales services to maximize value for every partner.

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 5

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 6

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 7

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 8

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 9
    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 10


    FAQ


    Q1: How do you guarantee stable product quality?

    A1: We implement a complete and strict quality control system covering raw material selection, synthesis and finished product testing. Every batch is fully inspected before delivery to ensure stable purity, safety and consistency.

    Q2: What are your advantages over other suppliers?
    A2: We are a direct manufacturer without middlemen, providing cost-effective prices and stable quality. With rich experience in international trade, we offer fast response, reliable delivery and professional after-sales service, winning wide trust from global customers.

    Q3: What is your ordering process?
    A3: Send us an inquiry with your detailed requirements. We will provide an official quotation including freight. After order confirmation and deposit/full payment, we will arrange production or immediate shipment once we receive your payment slip.

    Q4: Do you have products in stock?
    A4: Most mainstream peptide products are in regular stock for fast shipment. A few rare or customized specifications are not in stock and require a certain synthesis cycle. Please confirm the lead time before ordering.

    Q5: What is the MOQ?
    A5: The MOQ is 1 box (10 vials per box). Available specifications: 5mg, 10mg, 15mg, 20mg, 30mg per vial. Small trial orders are supported.

    Q6: Do you offer quantity discounts?
    A6: We provide tiered pricing. Larger order quantities enjoy more favorable prices. Long-term cooperative customers can get exclusive discount policies.

    Q7: Can I get samples for testing?
    A7: Sample testing is available. You can test the quality and purity first before placing bulk orders to reduce purchasing risk.

    Q8: How about your logistics and customs clearance?
    A8: We have stable cross-border delivery channels covering Europe, America, Russia, Central Asia and other regions. Door-to-door delivery is supported with smooth customs clearance and trackable shipping.

    Shop LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production-Detailed Image 11

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37 | CAS 154947-66-7 | 99% Purity | Human Antimicrobial Peptide | Factory Wholesale | Mass Production is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    #704-A008, Building 11, Block 16, Liangzhu Street, Yuhang District, Hangzhou City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1 days

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Our company located in Hangzhou City, is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.

    Our team of experienced professionals is committed to delivering innovative solutions and exceptional customer service. We work closely with our clients to understand their unique needs and develop customized products to meet their specific requirements. With a state-of-the-art manufacturing facility and strict quality control measures, we ensure that our products meet the highest standards of safety and purity.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.