Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Anti-seborrheic > LL-37 for Sale > Semax Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU NAD+ CAS154947-66-7
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - large image1
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - image1
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - image2
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - image3
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - image4
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - image5
Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 buy - image6

Semax Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU NAD+ CAS154947-66-7

TDS 3 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg / 10 mg / 20 mg. 10 bottles per box

Sample Available:

Yes

Price valid (until):

2027-04-01

Company Type:
Trader
Location:
Hongkong, China
Average Lead Time:
1 days
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager: Joanna

    WhatsApp:+85270574141

    Sincerely look forward to your inquiries about our products.

    High Purity Peptide Products for Research Use


    We specialize in supplying high-quality peptide products with advanced synthesis technology, strict quality management, and reliable global supply capabilities. Our products are manufactured under controlled production conditions and evaluated through professional analytical methods to ensure purity, consistency, and batch stability.

    With years of experience in international B2B trade, we provide flexible supply solutions for distributors, wholesalers, laboratories, and biotechnology partners worldwide. Our goal is to deliver reliable peptide products with professional service, efficient communication, and long-term cooperation.


    Product Features

    ✔ High Purity Standard


    Manufactured using advanced peptide synthesis technology with optimized purification processes to achieve high-quality standards and consistent product performance.


    ✔ Professional Quality Control


    Each production batch undergoes strict quality evaluation, including purity analysis, identification testing, and batch verification. Supporting quality documents are available according to customer requirements.


    ✔ Stable Supply Capability


    Equipped with professional production and supply management systems, ensuring stable availability, consistent batch quality, and efficient order fulfillment.


    ✔ Flexible Packaging Solutions


    Multiple packaging options are available, including bulk packaging, customized labeling, and private packaging solutions to meet different customer requirements.


    ✔ Global B2B Service


    Experienced in international business cooperation, supporting distributors, wholesalers, research organizations, and biotechnology companies across global markets.

    Shop Semaglutide   Tirzepatide   Retatrutide TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20-Detailed Image 1 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 2

    ——      Why Choose Us      ——

    1. Quality

    Each batch of our products will undergo corresponding quality inspections to ensure that the purity is above 99% before it is put on the market for sale, and there are corresponding test reports for reference.

    2. Price

    We are a company combining industry and trade,so we can provide competitive prices and high-quality products.

    3. Packaging

    We can package according to customer requirements and customize products.

    4. Transportation

    Door to door, we are responsible for door-to-door delivery, do not require you to have any customs clearance ability.

    5.After-sales service

    We guarantee the arrival of the goods. If the goods do not arrive due to force majeure, we will refund in full or reissue the goods for you.

    transport:

    Shop Semaglutide   Tirzepatide   Retatrutide TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20-Detailed Image 3

    ——      Our advantage    ——

    Our quality management process includes:

    • High-performance liquid chromatography (HPLC) testing

    • Mass spectrometry (MS) verification

    • Batch quality inspection

    • Raw material quality control

    • Professional documentation support

    Quality documents such as COA, analytical reports, and batch information can be provided upon request.

    Shop Semaglutide   Tirzepatide   Retatrutide TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20-Detailed Image 4

    —— Storage Conditions ——

    Should be stored in the refrigerator at 2°C to 8°C, away from light.

    If required, each single-dose pen can be stored unrefrigerated at a temperature not exceeding 30°C for up to 21 days, but once stored at room temperature it should not be returned to the refrigerator. If not used within 21 days after removal from the refrigerator, it should be discarded. Do not freeze tilpotide and if frozen, do not use.

    Shop Semaglutide   Tirzepatide   Retatrutide TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20-Detailed Image 5 Shop Semaglutide   Tirzepatide   Retatrutide TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20-Detailed Image 6 Shop Semaglutide   Tirzepatide   Retatrutide TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20-Detailed Image 7

    ——       Our factory      ——

    At the core of our operations is the unwavering commitment to our guiding principles : "Quality First, Service Supreme."Our mission is to spearhead advancements in biotechnology by consistently upholding the highest standards of quality and service. Through innovation and excellence, we aim to contribute to the betterment of global health and well-being.

    Our primary focus encompasses a range of products , including weight loss peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Tirzepatide, Retatrutide, and others.Provides reliable and timely custom manufacturing services for API following stringent quality system and close communication with the Clients.We have professional sales team , focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market, our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.

    With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers .

    Shop Tirzepatide RT5 RT10 RT15 RT20 RT30 RT40 Retatrutide  CAS2381089-83-2 RT30 RT40 RT50 RT60-Detailed Image 8 Shop Tirzepatide RT5 RT10 RT15 RT20 RT30 RT40 Retatrutide  CAS2381089-83-2 RT30 RT40 RT50 RT60-Detailed Image 9  Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 10

    ——        Customer Feedback       ——

    Shop Tirzepatide RT5 RT10 RT15 RT20 RT30 RT40 Retatrutide  CAS2381089-83-2 RT30 RT40 RT50 RT60-Detailed Image 11 Shop Tirzepatide RT5 RT10 RT15 RT20 RT30 RT40 Retatrutide  CAS2381089-83-2 RT30 RT40 RT50 RT60-Detailed Image 12

    ——      Packing & Delivery     ——

     

    ✔ Global Delivery Support

    We support shipments to customers in multiple regions worldwide, including:

    • North America
    • Europe
    • Asia-Pacific
    • Middle East
    • Other international markets

    Our logistics team provides shipment tracking, documentation support, and delivery coordination throughout the transportation process.


    ✔ Secure Packaging

    Products are carefully packed using professional packaging methods to help maintain product integrity during transportation.

    Packaging options include:

    • Standard export packaging
    • Customized customer packaging
    • Bulk order packaging solutions


    Shop Tirzepatide RT5 RT10 RT15 RT20 RT30 RT40 Retatrutide  CAS2381089-83-2 RT30 RT40 RT50 RT60-Detailed Image 13 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 14 Shop Tirzepatide RT5 RT10 RT15 RT20 RT30 RT40 Retatrutide  CAS2381089-83-2 RT30 RT40 RT50 RT60-Detailed Image 15

    Welcome to be our distinguished customer

    please do not hesitate to contact us!

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • Semax  Selank GT600(Brand) GT1500 CGL5 CGL10 NP810 LL37 GHK-CU  NAD+ CAS154947-66-7 Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Anti-seborrheic

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1 days

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.