Product
Supplier
Encyclopedia
Inquiry
Home > Organic Chemistry > Alcohols, Phenols, Phenol Alcohols > LL-37 for Sale > The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - large image1
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - image1
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - image2
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - image3
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - image4
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - image5
The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price buy - image6

The Chinese factory supplies LL37 CAS154947-66-7 at the most favorable price

1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Industrial Grade

Content:

99%

Port:

China

Brand:

JY

Packaging:

Bottle

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    CAS number 154947-66-7
    purity 99%


      Basic information  



    Application field Cosmetic raw material
    appearance particle
    Product name LL37
    CAS number 154947-66-7

    Shop Peptide powder Mazdutide cas 2259884-03-0-Detailed Image 1

    Shop Peptide powder Mazdutide cas 2259884-03-0-Detailed Image 2

    Shop Peptide powder Mazdutide cas 2259884-03-0-Detailed Image 3

    Shop Peptide powder Mazdutide cas 2259884-03-0-Detailed Image 4


      Packing and shipping information  


    Packing detail

    1kg: packed in food grade plastic bags in aluminum foil bags;

    10kg: packed in two food-grade plastic bags in a bucket;

    25kg: Packed in HDPE drum cardboard carton. Two plastic bags with food grade.

    (25 kg, 27.5 kg, size: 35 cm * 50 cm)

    Shop Nandrolon-e Decanoate 360-70-3 with low price-Detailed Image 4

    Shop High quality tisiparatide at a reasonable price CAS93384-43-1-Detailed Image 4



      Company Profile  


      Our company, Jianyan E-commerce Trading House in Yiwu City, is an innovative company mainly engaged in the research and development, production and sales of pharmaceutical intermediates and fine chemicals. The products are mainly used in the fields of medicine, health products, cosmetics, pesticides and electronic chemistry.

      We have a research and development centre and a production base. The R&D centre has advanced organic synthesis and analytical testing equipment. At the production base, we have large reaction vessels, including various specifications of stainless steel reaction vessels and enamel reaction vessels, capable of high-pressure,high-temperature and low-temperature reactions, with production capacities ranging from kilograms to tonnes. The company has established a comprehensive marketing network and its products are exported to countries and regions such as the United States, South Korea, Japan, India and Europe.

    Shop High quality tisiparatide at a reasonable price CAS93384-43-1-Detailed Image 6


    Shop Factory stock straight hair Apixaban free sample CAS503612-47-3-Detailed Image 7

    Shop Factory stock straight hair Apixaban free sample CAS503612-47-3-Detailed Image 8

    Shop High quality tisiparatide at a reasonable price CAS93384-43-1-Detailed Image 7 Shop High quality tisiparatide at a reasonable price CAS93384-43-1-Detailed Image 8


      FAQ  


    1. I did not find what I was looking for. Do you provide specific pack sizes or different packaging?

    We are all about finding or creating the right solution for you. Our team is ready to work with you to meet your specific needs, even for small quantities. Please contact us.

    2. Can I buy samples?

    Please feel free to contact us.

    3.What is your lead time?

    It depends on the proudct and order quantity. Please contact us.

    4. How can I get a price?

    After we get your inquiry, we usually quote within 24 hours.

    5. How can I place an order?

    Start order request, press 'Contact supplier,' or write us an email at mr-l@lemitebio.com and we will get back to you with an inquiry.  

    Basic Info

    Product Name:                    Cathelicidin                                                                                 CAS No.:                154947-66-7

    Molecular Formula:            C205H340N60O53                                                    



                                                                             

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Room 5003, 5th Floor, Yau Lee Centre, 45 Yuen Yuen Road, Kwun Tong, Hong Kong

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2024

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.