Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > FOXO4-DRI for Sale > Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - large image1
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - image1
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - image2
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - image3
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - image4
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - image5
Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation buy - image6

Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation

TDS 26 Inquiries

Unit Price:

$50-60/UNIT FOB

Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

LM

Packaging:

5mg/vial 10vials/box

Price valid (until):

2026-06-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name :Kim

    Email: sales3@xtlmh.com

    Whatsapp/wechat:+86 17659922905

    Product Description

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

    Function & Application

    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

    Appearance: Powder

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001

    Product Specification 

    Items Specifications
    Product Name Tirzepatide
    Other Name LY3298176
    CAS 2023788-19-2
    Molecular Formula C225H348N48O68
    Appearance White power
    Molar Mass
    4813.45

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 1 Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 2

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 3


      Company Profile   


    LingMi BioTechnology Co., Ltd, The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 4

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 5 Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 6


      Why choose us?  


    Our company has independent factories, mass production of pharmaceutical intermediates, organic intermediates and other raw materials, widely used in medicine, health care products, cosmetics, nutritional supplements, food additives and other fields.

    Our company adheres to the business philosophy of integrity and cooperation. scientific innovation and service first.With absolute quality assurance as the purpose and perfect service system as the basis, our company provides efficient and satisfactory consulting services, sincerely welcomes your business inquiries,and looks forward to working with you to create a new future.  

    Key Products:
    Our primary focus encompasses a range of products, including weight loss peptides, medicinal peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Semaglutide, Tirzepatide, Retatrutide, and others.

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 7


      Payment and Packaging  


    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 8

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 9 Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 10


    Advantage&shipping  


    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 11

    Shop Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation-Detailed Image 12


      FAQ  


    Q1: How to confirm the Product Quality before placing orders?
    A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.
    Q2: Can you supply free samples?
    A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.
    Q3: How do you treat quality complaints?
    A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.
    Q4: What's your MOQ ?
    A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
    Q: Is there a discount ?
    A: Yes, for larger quantity, we always support with better price.
    Q5: How to start orders or make payments ?
    A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


    Certificates
    • Purity 99% Slimming Peptide Freeze-dried Powder Cosmetics Raw Material FOXO4 CAS: 2460055-10-9 Batch Fast Delivery Safe Transportation Certificates 1

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

    Characteristics
  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Certifications:

    COA

    Company Profile
       Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

  • Inquiry History
    26 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    United States

    FOXO4

    10 PCS Nov 15, 2025
    United States

    Fox04

    1 G Nov 10, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.