 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > FDA registration LL37 Raw Material Powder 99% min Pharma Grade

FDA registration LL37 Raw Material Powder 99% min Pharma Grade buy - large image1

FDA registration LL37 Raw Material Powder 99% min Pharma Grade buy - image1

FDA registration LL37 Raw Material Powder 99% min Pharma Grade buy - image2

FDA registration LL37 Raw Material Powder 99% min Pharma Grade buy - image3

FDA registration LL37 Raw Material Powder 99% min Pharma Grade

Name: FDA registration LL37 Raw Material Powder 99% min Pharma Grade
Brand: APKX
SKU: pr2601041134
Price: 20 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$20-25/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Sample Available:

Yes

Price valid (until):

2026-12-16

Contact Supplier

 Chat Now

Tianjin Apex Import and Export Trading Co., Ltd.

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average Lead Time:

7 days

Qualification:

Main Products:

peptides

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Company Introduction

Salesperson: Zory

WhatsApp：+86 180 5357 9924 or +1 (608) 658-5770

Email：sales04@cnspks.com

We sincerely look forward to your inquiries about our products.

Shop Top Quality Tirzepatide Powder Fitness and Weight Loss 2023788-19-2-Detailed Image 1

Tianjin Apex Import and Export Trading Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.
We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly. Our customers come from countries including the United States, Europe,
Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment. Please let us know the specific quantity you need, and we will offer you the most competitive price. Feel free to contact us for more information.nput...

Shop Top Quality Tirzepatide Powder Fitness and Weight Loss 2023788-19-2-Detailed Image 4

1. LL37 has been used as an antimicrobial agent to improve wound healing.

2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

When storing peptides, remember to:
• Store peptide in a cold, dry, dark place
• Avoid repeated freezing and thawing of peptide
• Avoid overexposure to the air
• Avoid light exposure
• Avoid storing peptides in solution long term
• Aliquot peptide according to experimental requirements

Shop Top Quality Tirzepatide Powder Fitness and Weight Loss 2023788-19-2-Detailed Image 7

Shop Top Quality Tirzepatide Powder Fitness and Weight Loss 2023788-19-2-Detailed Image 8

Shop Top Quality Tirzepatide Powder Fitness and Weight Loss 2023788-19-2-Detailed Image 9

1. Customization & R&D Support

We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

Our services include:

* Custom peptide synthesis (mg to kg scale)

* Peptide modifications and labeling

* Small molecule synthesis

* Project-based research and scale-up

We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

2. Wide Product Portfolio

We supply a comprehensive and expanding product range:

* Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.

* Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.

* Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

3:FAQ

Q1:Are you a supplier or a manufacturer?

A:We are both a supplier and a manufacturer.

Q2:How will you deliver the goods?

A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

Q3:Which kind of payment terms do you accept?

A:, Bitcoin, PayPal.USDT.

Q4:How is the after-sales service?

A:We will provide high-quality products and ensure 100% safe deliver.

Q5:how can we guarantee quality?

A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

Q6: How to confirm the Product Quality before placing orders?

A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

Q7:Is there any discount?

A:Yes, for larger quantity, we always support with better price

Items	Specifications
Purity	99%
Appearance	powder
Storage	Store at -20°C
Delivery Time	3-5days

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
peptides

Location:
Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
7 days

Total Annual Revenue:
$10 million-$25 million

Total Employees:
11-50

Year of Establishment:
2025

Company Certificates
- .
- 证书
公司简介

Company Profile
We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 5 Excellent quality Safety Certified Professional-Grade Cost effective	Pharmaceutical Grade/99	$78-80/MT FOB	Ti.ZhenBo	Inquiry
Lab Grade LL-37 Antimicrobial Peptide CAS No 154947-66-7 Consistent Pure Peptides Powder For Research Use	Pharmaceutical Grade/99	$10/G FOB	Tranmoo	Inquiry
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support	Pharmaceutical Grade/99	$50-60/UNIT FOB	Hainan Terte New Materials Co., Ltd.	Inquiry
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale	Reagent Grade/99.9	$70/UNIT FOB	Yixin Biotechnology Co., Ltd.	Inquiry
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide	Pharmaceutical Grade/99	$100/UNIT FOB	Enshi Technology Co., Ltd.	Inquiry

FDA registration LL37 Raw Material Powder 99% min Pharma Grade

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller