LL-37

I. Basic Chemical Identification

• Common Names: LL-37, Antimicrobial Peptide LL-37
• Amino Acid Sequence: [LL-37, 37 aa] (linear 37-peptide, active fragment of human Cathelicidin family antimicrobial peptide)
• CAS Registry Number: 154947-66-7
• Molecular Weight: 4493.33 Da
• Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃

II. Key Physicochemical Properties

• Appearance: White loose powder, no visible foreign matter
• Solubility: Soluble in purified water and acidic aqueous solution, slightly soluble in non-polar organic solvents
• Stability: Stable in a dark, sealed and dry environment; freezing at -20℃ is recommended for long-term storage, avoiding repeated freeze-thaw

III. Synthesis & Quality Standards

Synthesis Process: Adopting standard Fmoc Solid-Phase Peptide Synthesis (SPPS) process, with mature and controllable process, which can accurately ensure the integrity of amino acid sequence.

• HPLC Purity: ≥98.0% (≥99.0% for research grade)
• Key Indicators: Qualified amino acid composition, moisture ≤8.0%, heavy metal (Pb) ≤10 ppm

IV. Storage & Transportation Requirements

• Packaging: Sealed packaging with built-in desiccant to avoid moisture absorption
• Storage: Frozen at -20℃, protected from light and moisture, avoiding high temperature and repeated freeze-thaw
• Transportation: General cargo channel, properly protected to avoid packaging damage and moisture absorption

V. Applications & Specifications

• Main Applications: Life science research; R&D of fine chemical intermediates
• Specifications: Marked "For Research/Chemical Raw Material Use Only", complying with relevant industrial standards