Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - large image1
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - image1
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - image2
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - image3
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - image4
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - image5
HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7 buy - image6

HOT Selling High Purity LL37 and good price Powder CAS 154947-66-7

1 Inquiries

Unit Price:

$151/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

SHENGYUFAN INTERNATIONAL TRADING CO.,LTD.

Packaging:

KIT

Price valid (until):

2027-09-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Items Specifications
    Product name LL37
    CAS NO. 154947-66-7
    Purity 99%

    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. Provide samples before regular order. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 1


      Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 2

      • Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 3

    Company Profile

    Shengyufan international trading co.,ltd.is an enterprise mainly in engaged in researching, producing and saling new-born API. Our company is located in Shijiazhuang city,Hebei province.
    We have many years of professional experiences and a professional team of scientists and advanced equipments. Nowadays we formed a large varieties large scale, complete categories and high technology content product chain. Our quality system has been accredited by SGS and our quality center guarantees quality with full documentation control and complete facilities.
    Based on the good quality, pretty competitive price and safe delivery our products are widely exported to many different countries, like Netherlands, Spain, UK, USA and so on. And our products are highly recognized by customers around the world, so we can build long-term cooperative relationship with many pharmaceutical enterprises in the world. We upload the principles of openness and transparency and dedicated to provide efficient and high quality services to every customer. We are sincerely looking forward to establishing a long-term stable and win-win business relationship with every customer.

    Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 4

    FAQ


    1.Q: Are you Trading Company or Manufacturer Factory?A: We have more than 20 years manufacturer experience. our own manufacturing
    bases for some items specially. Also all products have competitive price and quality guarantee.

    2.Q: Can I get some samples?
    A:Yes,we would like to supply samples.

    3.Q:What's your MOQ?
    A:Usually 1 box,we accept sample order.

    4.Q:How to delivery the goods?
    A:EMS/ EUB/ USPS/ UPS/ TNT/ FEDEX/ DHL etc

    5.Q:What's your delivery time.
    A:Usually 3-5 working days after your payment.

    6.What's your advantage?
    1. Best service, high quality and reasonable price 2. It's customers' right to choose the package (EMS, DHL, FedEx, UPS); 3. It's customers' right to choose the packing way for his products from many recent effective packing ways 4. Specials are possible when client's order is big enough, including the discount policy; 5. Our company promise to deliver clients' package to his hands safely, or we'll cover the total loss and reship in time

    Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 5

    —Why Choose us —

    Quality : Above 99% Purity, manufacturer direct supply the products,can supply the certificate of analysis, and can customize any content of powder.

    Transport : Over 99% customs clearance can be guaranteed, the delivery time within 3-7days and arrival time is 1-2 weeks, Even if the goods are detained, i will resend the goods.

    Service : We offer custom label and custom product services.We keep tracking the shippment until clients well received.We provide you with professional guidance on product use and product customization.

    Price : We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect.

    You get what you pay off, if you have any questions, i will have the answer. Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 6 Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 7 Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 8 Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 9

    Payment method

    Shop High Purity Lyophilized powder vials in stock MT1 CAS NO.  1566590-77-9-Detailed Image 10

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Green Home, No. 1, Jianming South Road, Chang'an District, Shijiazhuang City, Hebei Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Employees:

    5-10

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.