Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - large image1
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - image1
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - image2
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - image3
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - image4
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - image5
LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material buy - image6

LL37 CAS 154947-66-7 | Antibacterial Activity & Immune Research Raw Material

TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

Tranmoo

Packaging:

5mg*10vials

Price valid (until):

2026-04-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    WhatsAPP:+85247132718

    telegram:+85247132718

    Email:lxxxfffxxx@gmail.com


    Premium Quality for Research, Development, and Industrial Applications
    As a trusted global supplier, we provide a comprehensive range of high-purity peptides and biochemical compounds to support scientific innovation and product development. Our portfolio is designed for researchers, formulators, and manufacturers who require reliable, high-quality materials.

    Shop Bioactive VIP CAS 40077-57-4 for SARS-CoV-2 Induced Respiratory Failure Research-Detailed Image 1 Shop Bioactive VIP CAS 40077-57-4 for SARS-CoV-2 Induced Respiratory Failure Research-Detailed Image 2 Shop Bioactive VIP CAS 40077-57-4 for SARS-CoV-2 Induced Respiratory Failure Research-Detailed Image 3

    About Product

    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Bioactive VIP CAS 40077-57-4 for SARS-CoV-2 Induced Respiratory Failure Research-Detailed Image 4 Shop Bioactive VIP CAS 40077-57-4 for SARS-CoV-2 Induced Respiratory Failure Research-Detailed Image 5 Shop Bioactive VIP CAS 40077-57-4 for SARS-CoV-2 Induced Respiratory Failure Research-Detailed Image 6

    • Factory Footage

      Shop Retatrutide (CAS 2381089-83-2) Premium Research Peptide for Body Slimming and Lipolysis Studies-Detailed Image 6 Shop Retatrutide (CAS 2381089-83-2) Premium Research Peptide for Body Slimming and Lipolysis Studies-Detailed Image 7
      Shipping Methods

      Shop Retatrutide (CAS 2381089-83-2) Premium Research Peptide for Body Slimming and Lipolysis Studies-Detailed Image 8 Shop Retatrutide (CAS 2381089-83-2) Premium Research Peptide for Body Slimming and Lipolysis Studies-Detailed Image 9


    Customer Feedback

    Shop High Purity VIP (Aviptadine) CAS 40077-57-4 for Pulmonary Hypertension Research-Detailed Image 11 Shop High Purity VIP (Aviptadine) CAS 40077-57-4 for Pulmonary Hypertension Research-Detailed Image 12

    Why Source From Us?
    Uncompromised Quality & Verification: Every product is accompanied by comprehensive analytical documentation, including Certificates of Analysis (CoA) with HPLC purity data and Mass Spec (MS) confirmation, ensuring identity, purity (>98% typical), and batch-to-batch consistency.
    Research & Industry Focus: Our products serve the specific needs of R&D laboratories, pre-clinical studies, and commercial manufacturing for nutraceutical, cosmetic, and biotech applications.
    Supply Chain Reliability: We ensure secure, discreet, and temperature-controlled global shipping with reliable logistics partners to deliver your materials intact and on time.
    Customization & Scale: We offer flexibility from small-scale research quantities to large-volume bulk supply. Custom blending, specific purities, and private labeling are available for qualified partners.


    Frequently Asked Questions (FAQs)
    Q1: What documentation do you provide to verify product quality?
    A1: We provide a full Certificate of Analysis (CoA) for all products. For peptides, this includes HPLC purity chromatograms and Mass Spectrometry (MS) reports. For compounds like Botulinum Toxin or Cerebrolysin, we provide manufacturer-specific potency and quality control data. This ensures you receive precisely what you order.

    Q2: How are the peptides and blends formulated and shipped?
    A2: Peptides are typically supplied as sterile, lyophilized (freeze-dried) powders in sealed vials for maximum stability. Our proprietary blends (e.g., GLOW series) are precisely weighed and mixed under controlled conditions. All sensitive items are shipped with cold packs in insulated containers to maintain integrity.

    Q3: What is the typical lead time and minimum order quantity (MOQ)?
    A3: For standard in-stock items, lead time is 3-7 business days after order confirmation. MOQ varies by product but starts as low as 10 vial for many research peptides. We offer significant discounts for bulk and recurring commercial orders. Contact us directly for a specific quote.

    Q4: Can you create custom peptide blends or provide specific analogs?
    A4: Yes. Custom synthesis and blending are a core part of our service. We can develop tailored peptide combinations, specific concentrations, or modified analogs to meet your unique research or product development needs. Submit your specifications for a prompt consultation and quote.


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    shenzhenshilonggangqulongchengjiedaohuanggekengshequjiazhaoyeshidaidasha902

    Average lead Time:

    15

    Year of Establishment:

    2024

    Shenzhen Chuanmu Technology Co., Ltd .

    Shenzhen Chuanmu Technology Co., Ltd. stands at the forefront of the biotechnology industry as a specialized leader dedicated to the research, development, and sales of high-purity, bioactive peptides. We integrate cutting-edge scientific innovation with an unwavering commitment to quality, serving a global clientele across pharmaceuticals, cosmetics, nutraceuticals, and research institutions.

    Driven by a mission to harness the power of peptides for health and advancement, our core strength lies in our advanced R&D capabilities. Our team of expert scientists utilizes state-of-the-art synthesis, purification, and analytical technologies to produce peptides of exceptional purity, consistency, and biological activity. We offer a comprehensive portfolio, including custom peptide synthesis, catalog peptides, generic APIs, and novel peptide-based formulations tailored to specific client requirements.

    Quality and reliability are the bedrock of our operations. Our processes adhere to the most stringent international standards, ensuring every product meets rigorous specifications for safety and efficacy. We are more than just a supplier; we are a strategic partner, providing robust technical support, confidential collaboration, and scalable solutions from preclinical stages to commercial production.

    Based in the dynamic innovation hub of Shenzhen, China, Shenzhen Chuanmu Technology is poised to accelerate your next breakthrough. We empower our partners to pioneer new treatments, enhance product performance, and push the boundaries of scientific discovery.

    Our Promise: Precision in Every Chain. Innovation for a Healthier Future.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.