Product
Supplier
Encyclopedia
Inquiry
375 buy - large image1
375 buy - image1
375 buy - image2
375 buy - image3
375 buy - image4
375 buy - image5
375 buy - image6

375

1 Inquiries

Unit Price:

$100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.14%

Port:

shenzhen

Brand:

havhi

Packaging:

5mg/vial, 10vials/box

Price valid (until):

2026-09-18

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,GHK-CU,NAD+,KPV,SS-31

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    LL-37  is the only human cathelicidin antimicrobial peptide, a 37-residue cationic peptide derived from hCAP18. It exhibits broad-spectrum antimicrobial activity against Gram-positive/negative bacteria, fungi, and enveloped viruses, with low resistance risk. It modulates immune cell chemotaxis, cytokine release, and inflammation. It promotes angiogenesis and wound healing, and inhibits tumor growth. For research & cosmetic use only. Store at -20°C with cold-chain transport.

    Shop High purity AICAR  AR50-Detailed Image 1 Shop High purity AICAR  AR50-Detailed Image 2 Shop TA10-Detailed Image 2

    Items Specifications
    Category Peptides
    Purpose Weight Loss
    Purity 99.14%
    Specification 10mg 50mg 
    Storage Dry Cool Sealed Container
    Origin China


      Company Profile


    Havhi Technology Co., LimitedLimited is a formal enterprise with a valid Hong Kong company business license. We are a professional integrated manufacturer and supplier specializing in chemical raw materials, full-series high-purity peptide powder products, and cosmetic raw material ingredients.

    We have strict raw material screening and quality inspection procedures. All products feature high purity, stable performance, reliable quality and highly competitive wholesale prices.

    Our products are widely sold and exported to the United States, Canada, United Kingdom, Germany, France, Australia, New Zealand, the Middle East, Southeast Asia and European countries. We have built long-term cooperative relationships with customers all over the world and won unanimous praise and positive feedback from regular clients.

    We support flexible payment methods for global and US customers, including US customers can pay via Chime and Venmo.  But we mainly recommend: USDT, BTC, MoneyGram, Wise and Alipay.

    Sample service is available at any time if you need. We provide confidential, safe, fast door-to-door delivery, professional vacuum packaging and perfect after-sales service.

    We always adhere to the business philosophy of integrity first, quality assurance and customer supremacy. We sincerely welcome reliable buyers and distributors all over the world to contact us for inquiries, sample testing, quotation and long-term stable cooperation.


       About  US


    Q1: Has your product quality been certified by third-party laboratories?

    A: Yes. All our products have undergone rigorous testing by our quality control department, been verified by the quality assurance team, and approved by third-party laboratories in China. By choosing us, you are guaranteed to receive high-quality products.

    Q2: How do we cooperate with you?

    A: You can contact us via the information on our website to initiate cooperation, or reach out directly to our sales team. We will then communicate all specific details with you via email.

    Q3: Do you offer discounts?

    A: Yes. We always offer more favorable prices for large-volume orders.

    Q4: What payment options are available?

    A: US customers can pay via Chime and Venmo.  But we mainly recommend: USDT, BTC, MoneyGram, Wise and Alipay.

    Q5: How long does it take for the goods to arrive?

    A: It depends on your location. For small orders, delivery via DHL, UPS, TNT, FedEx or EMS usually takes 5-7 days. For bulk orders, air freight takes 5-8 days, while sea freight takes 20-35 days.

    Q6: Can I get a sample before placing an order?

    A: Yes,
    We can provide samples if necessary.

    Q7: Do you have a return and reshipment policy?

    A: We have comprehensive after-sales service and a reshipment policy for lost packages. We highly value long-term cooperation with our customers. We take great care in product packaging, and our customers can attest to this—even when locating products is difficult, our packaging ensures they are easy to identify. Despite our best efforts, a small number of packages may still be lost. In such cases, we promise to reship the goods free of charge to build a long-term partnership with you.


      Shipping&Packaging  


    We mainly adopt special line logistics and FedEx transportation methods. It can fully guarantee shipping timeliness, fast delivery, stable logistics track, safe and on-time arrival.Shop High Purity SM-Detailed Image 3 Shop High Purity SM-Detailed Image 4


      CONTACT US  


    please add my whatsapp:  +852 5682 7432

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,GHK-CU,NAD+,KPV,SS-31

    Location:

    1st Floor, Building 1, No. 2816 Yixian Road, Baoshan District, Shanghai

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.