Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37, Human Cathelicidin Antimicrobial Peptide
LL-37, Human Cathelicidin Antimicrobial Peptide buy - large image1
LL-37, Human Cathelicidin Antimicrobial Peptide buy - image1
LL-37, Human Cathelicidin Antimicrobial Peptide buy - image2

LL-37, Human Cathelicidin Antimicrobial Peptide

1 Inquiries

Unit Price:

$82-90/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

band

Packaging:

10 pieces per box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    LL-37 is a synthetic human cathelicidin antimicrobial peptide composed of 37 amino acid residues, derived from the C-terminal of human hCAP18 protein. This product is a high-purity lyophilized powder manufactured by solid-phase peptide synthesis, featuring stable molecular structure, low batch difference and high experimental repeatability. It is strictly supplied as a laboratory research-grade chemical reagent for in vitro academic study only.
    Items Specifications
    CAS No 154947-66-7
    Product Name LL37
    Molecular Weight 4493.33 Da
    Appearance White lyophilized powder
    Specification 10 pieces per box
    Origin Guangzhou
    Purity ≥98% HPLC
    Solubility Soluble in water, dilute acid and DMSO; insoluble in high-concentration salt solutions
    Storage Sealed and protected from light at -20°C; avoid repeated freeze-thaw cycles. Aqueous solution can be stored long-term at -80°C
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 1
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 2
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 3
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 4


      Usage Method  


    • 1. Reconstitution & Dissolution


      1. Before use, centrifuge the vial briefly to collect all powder at the bottom.
      2. Add appropriate solvent: ultrapure water, dilute acetic acid or DMSO is recommended.
      3. Gently swirl or pipette up and down slowly until fully dissolved; do not shake vigorously to avoid peptide denaturation.
      4. Prepare working solution on demand. Avoid long-term storage of aqueous solution.

      2. Recommended Working Concentration


      • Antibacterial / Anti-biofilm test: 1 – 10 μM
      • Cell experiment (Immunomodulation / Wound healing): 0.5 – 5 μM
      • Skin care formulation: 0.1 – 2 μM (formulate per formula requirements)

      3. Dilution Steps


      Calculate the required solvent volume based on target concentration. Example for reference:

      Take 1 mg LL-37 (MW: 4493.33 Da)

      • Moles of 1 mg peptide: ≈ 2.2255×10⁻⁷ mol
      • To prepare 10 μM stock solution: add 0.022255 L (22.26 mL) solvent

      4. Storage After Dissolution


      • Stock solution: Aliquot and store at -80°C, valid for 3–6 months.
      • Avoid repeated freeze-thaw cycles.
      • Working solution: Use immediately after preparation.

      5. Operation Notes


      1. Wear gloves and masks during operation to prevent contamination.
      2. Do not use high-salt solution for initial dissolution, which may cause precipitation.
      3. Keep away from proteases to prevent peptide degradation.
      4. For in vitro research & formula use only. Not for direct human injection or oral administration.
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 5
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 6
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 7
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 8


      LL-37 Storage Methods  


    1. Unopened Lyophilized Powder


    1. Long-term storage: Seal tightly and keep away from light at -20°C. Shelf life: 24 months.
    2. Temporary storage: Store at 15–25°C for no more than 7 days.
    3. Environmental requirement: Keep dry, away from heat sources and strong light.

    2. Reconstituted Stock Solution


    1. Aliquot into single-use portions and freeze at -80°C. Valid for 3–6 months.
    2. Avoid repeated freeze-thaw cycles to prevent activity loss and peptide degradation.
    3. For short-term use (1–2 weeks): Keep sealed and shaded at 2–8°C.

    3. Working Solution


    Prepare and use immediately. Do not store for a long time at room temperature or under refrigeration.

    4. Additional Notes


    1. Centrifuge the vial briefly before opening to prevent powder scattering and moisture absorption.
    2. Keep away from proteases and high-salt solutions to avoid inactivation.
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 9
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 10
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 11
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 12


     Hong Kong Bosen Peptide R&D Co., Limited


    Hong Kong Bosen Peptide R&D Co., Limited is a professional biotechnology company headquartered in Hong Kong, with a focus on peptide research, development, production and global supply. Rooted in the Greater Bay Area’s strong biotech ecosystem, we integrate cutting-edge R&D capabilities, strict quality control systems and efficient global logistics to deliver high-quality peptide products and technical solutions to customers worldwide.

    Core Business & Product Portfolio


    We specialize in the R&D, customization and commercial production of high-purity peptides, modified peptides and related biotech raw materials. Our product portfolio covers:

    • Therapeutic peptides: SS-31 (Elamipretide), Tirzepatide, Semaglutide, Retatrutide (RT20), etc.
    • Functional peptides: GHK-Cu, TB500, KPV, NAD, Glutathione, etc.
    • Custom peptide services: Custom synthesis of complex sequences, long-chain peptides (up to 200 amino acids) and cyclic peptides, as well as various modification services (N-methylation, unusual amino acid incorporation, etc.).

    R&D & Manufacturing Strength


    • Technical expertise: Mastery of core technologies including solid-phase peptide synthesis (SPPS), liquid-phase synthesis, advanced purification (HPLC) and strict structural characterization.
    • Quality assurance: All products are produced in compliance with cGMP standards, with complete CoA, HPLC and MS reports to ensure batch-to-batch consistency and high purity (≥98%).
    • Production capacity: Equipped with professional production bases in Guangzhou, supporting small-batch R&D samples to large-scale commercial production, with stable supply capacity.

    Global Market & Service Philosophy


    With a customer base spanning the Philippines, the United States, Brazil, Russia, Bangladesh and other regions, we adhere to the service philosophy of "Quality First, Customer Centric". We provide one-stop services including product consultation, customization, technical support and global logistics solutions (door-to-door delivery, customs clearance assistance), committed to becoming a reliable long-term partner for global biotech enterprises, research institutions and health industry clients.

    Vision


    We are dedicated to advancing peptide technology innovation, expanding the application of peptides in health and medical fields, and contributing to global human health with high-quality products and professional services.
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 13
    Shop LL-37, Human Cathelicidin Antimicrobial Peptide-Detailed Image 14

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

    Location:

    RM 701, UNIT 108, 7/F, TWR B NEW MANDARIN PLAZA 14 SCIENCE MUSEUM RD TSIM SHA TSUI HONG KONG

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.