Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > PNC-27 for Sale > 99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - large image1
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - image1
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - image2
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - image3
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - image4
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - image5
99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies buy - image6

99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies

1 Inquiries

Unit Price:

$141-150/MT FOB

Get Latest Price
CAS No.:

1159861-00-3

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

HNYH

Packaging:

5mg/vial,10vial/box

Price valid (until):

2026-07-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Shop 99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies-Detailed Image 1


      99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies  


    PNC-27 is a 32-residue synthetic peptide composed of an HDM-2 binding domain derived from the p53 tumor suppressor protein (residues 12–26) linked to a penetratin cell-penetrating leader sequence . This peptide functions as a research tool for studying protein-protein interactions involving HDM-2 and p53 pathways. It is supplied as a sterile lyophilized powder in sealed vials, ensuring high stability and bioactivity for research purposes only.

    For laboratory research purposes only. Not for human or veterinary use. Not for diagnostic or therapeutic applications.

    PNC-27 contains the p53-derived sequence that binds to the N-terminal p53 binding site of HDM-2 . The penetratin domain facilitates cellular uptake and proper peptide folding. Research studies have investigated its interactions with HDM-2 protein, which is expressed in the membranes of various cancer cell lines .

    The lyophilized formulation preserves the peptide's structural integrity and bioactivity, allowing for consistent and reproducible results in controlled laboratory settings. Each vial is hermetically sealed to prevent moisture absorption and contamination. The product is intended for in vitro research applications, including cell culture studies, protein binding assays, and receptor interaction analyses.

    Key Research Applications: Protein-protein interaction studies, HDM-2/p53 pathway research, cell membrane protein targeting investigations, receptor binding assays, in vitro cancer cell biology studies.

    Item Specification
    Product Name PNC-27
    CAS No. 1159861-00-3 
    Synonyms PNC-27 anticancer peptide, p53-derived peptide, HDM-2 binding peptide
    Molecular Formula C₁₈₈H₂₉₃N₅₃O₄₄S 
    Molecular Weight 4031.73 g/mol 
    Amino Acid Length 32 residues 
    Full Sequence H-Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH 
    Sequence Short PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG 
    Domains p53-derived HDM-2 binding domain (residues 12-26) + Penetratin leader sequence 
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Available Dosages 5mg per vial, 10mg per vial (custom dosages available for bulk orders)
    Pack Size 10 vials per kit
    Storage Condition -20°C, protect from light, keep sealed 
    Shelf Life 36 months (unopened, stored at -20°C) 
    Solubility Soluble in sterile water or DMSO
    Grade Research Grade
    Sterility Sterile filtered, endotoxin tested
    Application For laboratory research use only

    Shop 99% Purity PNC-27 CAS 1159861-00-3 Anticancer Research Peptide 5mg 10mg per Vial for Cancer Cell Biology Studies-Detailed Image 2

    Category Description
    🔬 High Purity ≥99% purity by HPLC, COA provided with each batch
    📦 Multiple Dosages Available in 5mg and 10mg per vial
    🧪 Strict QC Each batch tested by HPLC and Mass Spectrometry
    🔬 Dual-Domain Structure HDM-2 binding domain + penetratin cell-penetrating sequence 
    🌍 Global Shipping FedEx/UPS/special line available, free shipping on orders over $1000
    Application Area Description
    Protein-Protein Interaction Studies Investigation of HDM-2/p53 binding domain interactions 
    HDM-2 Targeting Research Study of HDM-2 protein expression and binding in cell lines 
    Cell Membrane Protein Research Analysis of membrane-bound protein targeting mechanisms 
    Receptor Binding Assays Characterization of peptide-protein binding affinity and specificity
    In Vitro Cancer Cell Biology Laboratory studies of cellular responses in cancer cell lines
    Peptide Internalization Studies Research on cell-penetrating peptide mechanisms 
    Mitochondrial Research Investigation of peptide-mitochondrial membrane interactions


    Packaging & Shipping  


    Shop High Purity KissPeptin-10 CAS 374675-21-5 5mg 10mg per Vial 10 Vials per Kit for Reproductive Endocrinology and Hormone Research Laboratory Study-Detailed Image 3 Shop High Purity KissPeptin-10 CAS 374675-21-5 5mg 10mg per Vial 10 Vials per Kit for Reproductive Endocrinology and Hormone Research Laboratory Study-Detailed Image 4

    Shop High Purity KissPeptin-10 CAS 374675-21-5 5mg 10mg per Vial 10 Vials per Kit for Reproductive Endocrinology and Hormone Research Laboratory Study-Detailed Image 5


    Packaging Structure (From Outer to Inner)


    Level Description

    Outer Packaging Standard cardboard box

    Middle Packaging Product box (branded/plain) containing a plastic box inside

    Inner Packaging Plastic box holding 10 glass vials with foam or partition protection

    Vial Clear glass vial, aluminum-plastic flip-off seal, labeled with product name, dosage, and batch number


    Each Plastic Box Contains:
    10 vials of PNC-27 (5mg or 10mg per vial)

    The vial is individually sealed with label

    Foam or plastic partition to prevent vials from bumping into each other


    Shipping Methods & Delivery Time
    Shipping Method Cost Delivery TimeSpecial Line/ Express $40 (under 5kg) ~14 days
    UK Special Line Same as above ~25 days (slightly delayed)
    UPS / FedEx $70 7-10 daysShipping Policies


    Policy Details
    Free Shipping On orders over $1000
    Remote Area Fee Some remote areas may incur an extra $35 (as determined by FedEx/UPS)
    Lead Time 3-5 business days after payment confirmation


    Frequently Asked Questions (FAQ)
    Q1: Can I get a sample before placing an order?

    Yes, samples are available upon request. Samples are not provided for free. You will need to pay for both the sample cost and the shipping fee. The sample fee will be deducted from your bulk order payment once you proceed with a formal order.

    Q2: What payment methods do you accept?

    We accept wire transfer (T/T), PayPal, and bank transfer. You may choose the most convenient method for you.

    Q3: How and when can I receive my order after payment?

    Small quantity orders: Shipped via international express (DHL, FedEx, UPS, etc.). Delivery time: 7-10 days after shipment.

    Large quantity orders: Shipped by sea. Delivery time: 15-30 days depending on the destination port.

    Special line: ~14 days delivery time (under 5kg, $40).

    Q4: Can I use my own label or packaging?

    Yes, OEM service is available for bulk orders. We can customize labels, vial dosage, vial cap color, and packaging according to your requirements. Please contact us for details.

    Q5: What is your MOQ (Minimum Order Quantity)?

    Retail MOQ: 1 kit/dosage/item

    Customized packaging (e.g., custom vial size, cap color): 20-50 kits/dosage/item

    Q6: Do you provide a Certificate of Analysis (COA) with each order?

    Yes, each batch comes with a COA (HPLC purity test report). Third-party testing is also available upon request.

    Q7: How should I store the peptide?

    Store at -20°C, protected from light, and keep sealed. Once reconstituted, refrigerate at 2-8°C and use within the recommended timeframe.

    Q8: What documents will be included with my shipment?

    Commercial invoice, packing list, COA, and MSDS will be included with each shipment.

    Basic Info
    Product Name:

    PNC-27

    Other Name:

    PNC27

    CAS No.:

    1159861-00-3

    Molecular Weight:

    0

    Characteristics
  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    Lobby of Area B, Area E, Area F and Area G (Central Office Area), Landao Research Center, No.3 Yingbin Road, Yangpu Economic Development Zone, Hainan Province

    Payment Terms:

    TT against copy of documents,D/P

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Certifications:

    Retatrutide,Retatrutide,Retatrutide,Retatrutide

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    PNC27

    10 PCS Apr 11, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.