 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling

Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling buy - large image1

Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling buy - image1

Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling buy - image2

Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling buy - image3

Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling buy - image4

Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling

Name: Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling
Brand: Pharma;Conutrix
SKU: pr2606171411
Price: 33 USD
Availability: InStock

TDS 9 Inquiries

Unit Price:

$33/UNIT FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

tianjin

Brand:

Pharma;Conutrix

Packaging:

10 vials/box

Price valid (until):

2026-07-17

Contact Supplier

 Chat Now

Anhui Ruibang Trading Co., Ltd

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

1. Basic Information

Product Name: Teriparatide Peptide

Classification: Synthetic biologically active recombinant polypeptide fragment

Structure: 34-amino-acid peptide, corresponding to the N-terminal active fragment of human parathyroid hormone (PTH 1–34)

Purity: ≥98%–99% (HPLC tested, research grade)

Appearance: White sterile lyophilized powder

Teriparatide is a high-activity synthetic polypeptide consisting of the first 34 amino acids of human parathyroid hormone. It retains the complete biological activity of endogenous PTH with stable molecular structure and high receptor affinity. This bionic peptide features excellent human biocompatibility, mild physiological regulation, no residual accumulation, and no drug dependence. It is widely applied in bone metabolism research and physiological regulation studies with reliable safety and stability.

2. Mechanism of Action

Teriparatide exerts targeted bone metabolism regulation by binding to parathyroid hormone receptors on osteoblasts and bone tissue cells. Different from passive bone improvement ingredients, it actively activates osteoblast proliferation and differentiation, stimulates new bone tissue formation, and enhances bone matrix synthesis and mineralization. It precisely regulates calcium and phosphorus metabolism balance in the body to maintain normal bone physiological environment.

This peptide inhibits excessive osteoclast activity, reduces abnormal bone resorption and bone loss rate, and reverses the imbalance between bone formation and bone resorption caused by aging or metabolic disorders. It improves microcirculation of bone tissue, enhances bone cell vitality, repairs damaged bone microstructure, and comprehensively optimizes bone density and bone tissue stability.

3. Core Biological Functions

Promote New Bone Formation & Improve Bone Density Teriparatide specifically activates osteoblast function, accelerates new bone tissue synthesis and mineralization, effectively increases bone density, and improves bone tissue structure. It fundamentally improves sub-health problems such as loose bone structure and insufficient bone metabolism.

Inhibit Bone Loss & Balance Bone Metabolism It suppresses the over-proliferation of osteoclasts, reduces excessive bone resorption, balances the dynamic cycle of bone formation and bone absorption, and effectively delays age-related bone metabolism decline and bone loss symptoms.

Regulate Calcium & Phosphorus Metabolic Homeostasis The peptide stably regulates blood calcium and blood phosphorus levels, promotes effective calcium deposition in bone tissue, improves abnormal mineral metabolism, and maintains the normal physiological function of the skeletal system.

Repair Bone Microstructure & Enhance Bone Toughness It repairs damaged and loose bone microstructures, improves bone tissue compactness and mechanical toughness, enhances skeletal support capacity, and improves overall bone health status.

4. Reconstitution and Concentration Specification

10 mg Teriparatide lyophilized powder reconstituted with 5 mL BAC water

Final Concentration: 2 mg/mL

Note: Each 1 mL of reconstituted solution contains 2 mg of active Teriparatide polypeptide.

5. Safety Profile

Teriparatide is a high-purity bionic synthetic polypeptide with highly targeted and mild regulatory effects. It has excellent human biocompatibility, no systemic toxicity, no local irritation, no hormone disturbance and no drug dependence. After participating in bone metabolism regulation, it can be completely decomposed and metabolized in vivo without tissue accumulation or adverse side effects, supporting safe long-term laboratory research application.

6. Storage Instructions

Sealed lyophilized powder should be stored at -20°C, kept sealed, dry and protected from light. Reconstituted solution must be stored at 2–8°C and used within 7 days to maintain optimal biological activity and prevent peptide inactivation.

7. Disclaimer

Teriparatide Peptide is a research-grade experimental peptide for laboratory research and technical reference only. It is not a pharmaceutical product and shall not be used for medical diagnosis, treatment or clinical medication purposes.

Shop Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling-Detailed Image 1

Shop Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling-Detailed Image 2

Shop Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling-Detailed Image 3

Items	Specifications

About us

Anhui Ruibang Trading Co., Ltd. was established with a clear mission: to simplify international trade for businesses of all sizes. We act as a bridge between manufacturers and global buyers, offering professional sourcing, quality inspection, order coordination, and logistics management.

Our team brings years of experience in cross-border trade, supplier networks, and export documentation. We understand the challenges of international business — language barriers, quality control, shipping complexities — and we solve them with a client-first approach.

At Ruibang Trading, we don’t just move goods; we build relationships. Whether you are looking for a reliable supplier, need help consolidating shipments, or want to expand your product line, we provide tailored solutions to meet your goals.

Our Commitment: Integrity, efficiency, and transparency in every transaction.

Why choose us

As a professional original peptide manufacturer integrating independent R&D, production and sales, we stand out in the global peptide industry with reliable quality, stable supply and cost-effective solutions, serving global clients engaged in scientific research, biotech, healthcare and cosmetic fields.

Quality is our core competitive advantage. We strictly follow standardized production and quality control systems, with all peptide products including Vesugen polypeptide tested by high-precision HPLC to ensure a purity of 98%-99%. Equipped with independent sterile laboratories and advanced testing equipment, we conduct full-process monitoring from raw material screening, synthesis, purification to lyophilization. Every batch of products comes with complete test reports, guaranteeing high stability, high activity and zero impurities, fully meeting international research and commercial application standards.

We own standardized automated production lines to support flexible and scalable production. We efficiently handle orders ranging from small-batch trial samples to large-scale bulk customization, realizing stable mass production while shortening delivery cycles. Different from middlemen and distributors, we have full control over production links, effectively cutting intermediate costs and offering factory-direct competitive prices without compromising product quality.

Supported by a professional technical team with years of peptide synthesis experience, we master mature lyophilization and peptide modification technologies. Besides conventional peptide products, we provide one-stop customized services including exclusive sequence synthesis, formula optimization and professional reconstitution guidance. We offer accurate technical instructions for product dilution, concentration calculation and storage, solving all technical problems for clients.

We adhere to strict warehouse and logistics management. Lyophilized peptides are stored in low-temperature and light-proof environments to ensure long-term activity retention. We provide secure vacuum packaging and global fast delivery, along with thoughtful after-sales support. Choosing us means you gain high-quality products, professional technology, stable supply and cost-effective prices all in one reliable partner.

. Shop Teriparatide 99% Pharmaceutical Grade High Purity Factory SupplyHot selling-Detailed Image 4

Certificates

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Retatrutide,Tirzepatide,Semaglutide,Cynomorium Songaricum Extract,Bull Penis Powder,Deer Penis Extract

Location:
Hefei, Provincia de Anhui

Year of Establishment:
2026

Inquiry History

9 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide Acetate Peptide Supplier Best Price 5mg 10mg 15mg 60mg,whole sale price	Pharmaceutical Grade/99		Ningbo Shu You plastic Co., LTD	Inquiry
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry