Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - large image1
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - image1
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - image2
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - image3
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - image4
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - image5
LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder buy - image6

LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder

TDS 1 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99.89%

Port:

Shenzhen

Brand:

XH

Packaging:

1 mg / 5 mg / 10 mg / 25 mg / 50 mg per vial/Available upon request

Price valid (until):

2026-07-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    1. Product Overview

    LL-37 is a human-derived cationic antimicrobial peptide consisting of 37 amino acids, belonging to the cathelicidin family of host defense-related peptides. It is the only known human cathelicidin peptide and is widely studied in the field of innate immunity, cellular signaling, and peptide biology research.

    This product is supplied as a synthetic, high-purity lyophilized powder designed strictly for laboratory research use only (RUO). It is manufactured under controlled conditions to ensure batch-to-batch consistency, high sequence fidelity, and stable physicochemical properties suitable for advanced biochemical and molecular biology applications.

    LL-37 is frequently used in experimental studies involving peptide-membrane interactions, inflammatory signaling pathways, microbial membrane modeling, and structural biology research.

    Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 1 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 2 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 3

    Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 4


    2. Chemical & Physical Information

    • Product Name: LL-37 (Human Cathelicidin Peptide)
    • CAS Number: 154947-66-7
    • Sequence Length: 37 amino acids
    • Molecular Type: Synthetic linear peptide
    • Appearance: White to off-white lyophilized powder
    • Purity: ≥ 95% / ≥ 98% (depending on specification batch)
    • Solubility: Soluble in sterile water or dilute acidic aqueous solutions
    • Storage: 2–8°C for short-term; -20°C for long-term stability
    • Stability: Stable under lyophilized conditions when protected from moisture and light
    • Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 5 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 6 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 7 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 8 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 9 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 10 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 11 Shop LL-37 Cathelicidin Antimicrobial Peptide Human CAS 154947-66-7 Research Grade Powder-Detailed Image 12

    3. Structural Characteristics

    LL-37 is characterized by its amphipathic and cationic structure, which allows it to interact with lipid bilayers and biological membranes in experimental systems. Its structural flexibility makes it a valuable model peptide in studies involving:

    • Peptide–membrane interaction modeling
    • Charge-based molecular binding studies
    • Structural conformation analysis under different environmental conditions
    • Protein folding and aggregation behavior in vitro

    Due to its unique sequence and physicochemical profile, LL-37 is widely utilized in comparative peptide research and computational biology simulations.


    4. Research Applications (Non-Clinical Use Only)

    This product is intended exclusively for scientific research and laboratory experimentation. Common research areas include:

    4.1 Molecular Biology Research

    • Peptide structure-function relationship studies
    • Gene expression pathway analysis in vitro models
    • Protein interaction screening assays

    4.2 Biochemistry & Biophysics

    • Lipid bilayer interaction studies
    • Membrane permeability and binding experiments
    • Circular dichroism (CD) spectroscopy analysis
    • Mass spectrometry and peptide profiling research

    4.3 Immunology Research Models

    • Innate immune response simulation systems
    • Cell signaling pathway exploration in laboratory models
    • Cytokine-related pathway observation in controlled environments

    4.4 Microbiology & Biointerface Studies

    • Microbial membrane model systems
    • Surface interaction and charge dynamics research
    • Biofilm-related experimental modeling (non-therapeutic research only)

    4.5 Pharmaceutical & Peptide Discovery Research

    • Peptide analog development studies
    • Structure modification and SAR (structure-activity relationship) research
    • Drug delivery system experimental modeling (preclinical stage only)

    5. Manufacturing Process

    LL-37 is produced using solid-phase peptide synthesis (SPPS) technology, a widely accepted method for high-precision peptide production. The manufacturing process includes:

    1. Amino acid sequential coupling
    2. Chain elongation under controlled reaction conditions
    3. Cleavage and deprotection steps
    4. Crude peptide purification
    5. High-performance liquid chromatography (HPLC) refinement
    6. Lyophilization under sterile, low-moisture conditions
    7. Final quality testing and batch validation

    Each batch undergoes strict quality control to ensure sequence accuracy, purity consistency, and reproducibility across research applications.


    6. Quality Control Standards

    Each production batch is tested using analytical methods including:

    • HPLC purity analysis
    • Mass spectrometry (MS) confirmation
    • Amino acid composition verification
    • Water content analysis (Karl Fischer method)
    • Microbial limit testing (where applicable for research grade materials)

    Only batches that meet predefined acceptance criteria are released for distribution.


    7. Packaging Information

    • Standard vial sizes: 1 mg / 5 mg / 10 mg / 25 mg / 50 mg
    • Form: Lyophilized sterile peptide powder
    • Primary container: Sterile borosilicate glass vial
    • Sealing system: Rubber stopper with aluminum crimp seal
    • Secondary packaging: Individual sealed protective foil pouch
    • Outer packaging: Laboratory-grade carton box for shipping protection
    • Label details: Product name, CAS number, batch number, purity, storage conditions

    Custom packaging options are available for bulk laboratory orders.


    8. Storage & Handling

    To ensure product stability and integrity:

    • Store at 2–8°C for short-term use
    • For long-term storage, keep at -20°C or below
    • Avoid repeated freeze-thaw cycles
    • Protect from moisture, heat, and direct light exposure
    • Use sterile techniques when handling reconstituted solutions

    Proper storage conditions are essential to maintain peptide stability and experimental reliability.


    9. Shipping & Stability

    The product is shipped under controlled conditions suitable for peptide materials:

    • Cold-chain or temperature-controlled packaging available upon request
    • Dry ice shipping recommended for long-distance transport
    • Stability maintained under lyophilized state during transit
    • Fast logistics handling to minimize environmental exposure

    Upon receipt, immediate storage under recommended conditions is advised.


    10. Intended Use Disclaimer

    This product is provided strictly for laboratory research use only. It is not intended for:

    • Human consumption
    • Veterinary or clinical use
    • Diagnostic or therapeutic applications
    • Household or personal care use

    All handling and usage must be performed by qualified laboratory personnel in appropriate controlled environments.


    11. Advantages of This Product

    • High purity and consistent batch quality
    • Reliable synthetic production process
    • Suitable for advanced biochemical research
    • Stable lyophilized formulation
    • Compatible with a wide range of laboratory techniques
    • Strict quality control and documentation support

    12. Summary

    LL-37 is a well-characterized human peptide widely utilized in scientific research focused on molecular interactions, membrane studies, and cellular signaling models. This product is manufactured under strict quality standards to support reproducible and high-level laboratory investigations.

    Its structural uniqueness and biological relevance make it a valuable research tool in peptide science and related experimental fields.

    Items Specifications
    mg vials
    g bag
    kg White freeze-dried powder

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

    Location:

    Block 1, No. 205, Tongbao Road, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province (within Zhejiang Juzhiyun Holding Co., Ltd., on the 4th floor of 2 buildings)

    Payment Terms:

    TT against copy of documents,O/A,100% TT in advance

    Total Employees:

    101-200

    Year of Establishment:

    2026

    Company Profile

    Yiwu Xinhong Trading Co., Ltd. is a professional trading company engaged in the international supply and distribution of peptides, chemical raw materials.
    Leveraging a reliable network of qualified manufacturers and strategic partners, we provide customers with high-quality products, competitive pricing, and efficient supply chain solutions. Our products are widely used in pharmaceutical research, biotechnology, chemical manufacturing, laboratory research, and various industrial applications.

    With extensive experience in international trade, we are committed to helping customers source quality chemical products from China through professional procurement services, strict supplier selection, and reliable logistics support. We focus on building long-term partnerships by delivering consistent quality, responsive communication, and dependable service.

    Main Products
    Peptides
    Chemical Raw Materials
    Organic Chemicals
    Inorganic Chemicals
    Fine Chemicals
    Our Advantages
    Professional international trading services
    Reliable supplier network
    Competitive pricing and flexible sourcing
    Strict quality control and supplier management
    Fast response and efficient communication
    Global export and logistics support
    Business Scope

    Global sourcing, international trade, import and export of chemical products, customized procurement solutions, and supply chain services.

    Markets

    Europe, North America, South America, Southeast Asia, the Middle East, and other international markets.

    Yiwu Xinhong Trading Co., Ltd. is committed to providing professional chemical sourcing solutions and creating long-term value for customers worldwide. We look forward to establishing mutually beneficial partnerships with clients across the globe.

    Business Type: Trading Company
    Company Name: Yiwu Xinhong Trading Co., Ltd.
    Main Business: Peptides, Chemical Raw Materials
    Market: Global

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.