Product
Supplier
Encyclopedia
Inquiry
Home > Chemical Reagents > Organic Reagents > LL-37 for Sale > Retatrutide TB500 LL37 GHK-CU BT5 BT10 375 CU50 CU100 CAS154947-66-7 Recombinant peptide
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - large image1
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - image1
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - image2
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - image3
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - image4
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - image5
Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide buy - image6

Retatrutide TB500 LL37 GHK-CU BT5 BT10 375 CU50 CU100 CAS154947-66-7 Recombinant peptide

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5mg/ 10mg/ 15 mg/ 20 mg/ 30mg/ 40mg/ 50 mg/ 60mg/ 100mg. 10 bottles per box

Price valid (until):

2027-10-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——


    Our peptide products are directly supplied by source factories in China, with full independent control over the entire process from raw material extraction to synthetic production, ensuring product quality at the source. The core peptide ingredients achieve 99% ultra-high purity purification and feature high-concentration active properties with stable molecular structures. They can be precisely adapted to the R&D and production needs of various cosmetic and skincare formulations such as face-slimming skincare products, beauty serums, and facial care freeze-dried powders, providing a solid ingredient foundation for the core efficacy of products like face-slimming, firming, and contour shaping.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Safe delivery of personalized peptides-Detailed Image 1

    ——      Why Choose Us      ——

    1.We have more than 10 years of experience in the field of chemical industry, the company's products are exported to more than 60 countries overseas, of which 80% are exported to Europe and America, 20% are exported to Southeast Asia, the Middle East, South Africa and other regions.

    2.We have our own production plant and R & D center, to provide customers with technical support, product customization, free recipes and other whole industry chain services. Support full video inspection, testing, global delivery package.

    3.We accept sample orders for testing, after purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your future problems. 100% quality assurance, 100% safe delivery.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Safe delivery of personalized peptides-Detailed Image 2

    ——      Our advantage    ——

    We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can contact us about peptides

    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product. We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides. The feedback from customers who have ordered our products (peptides) is very good. Reliable buyers around the world can contact us for peptide matters. We offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.We look forward to the opportunity to work with you and help you succeed.

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 4

    ——       FAQ      ——

    Q: Could you please tell me about the lifespan or durability of this product?

    A: The specific usage period of the product mainly depends on the actual usage volume and frequency of the customer.

    Q: How much experience and reputation does your company have in the industry?

    A: Our company has many years of operating experience in the industry and is renowned for its excellent product quality and high-quality customer service. We enjoy a good reputation in the industry and have a group of loyal customers who have been cooperating with us for a long time.

    Q: What are your company's return and refund policies?

    A: We have a flexible and customer-oriented return and refund policy. If the goods are damaged during transportation, we will provide a full refund or a free replacement to fully protect the rights and satisfaction of the customers.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Safe delivery of personalized peptides-Detailed Image 4 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Safe delivery of personalized peptides-Detailed Image 5 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Safe delivery of personalized peptides-Detailed Image 6

    ——       Our factory      ——

    We are a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.
    As a leading peptide manufacturer,We have a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.
    In terms of production technology, We adopt internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.
    Our company adhere to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.
    In the future,We will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 8 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 9


    ——        Customer Feedback       ——

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 10 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 11


    ——      Packing & Delivery     ——

    Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 12 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 13 Shop VIP5 VIP10 IG01 IG1 VIP  IGF-1LR3 KissPeptin-10 LYSINE-PROLINE-VALINE KPV5 KPV10 Factory quotation-Detailed Image 14


    Welcome to be our distinguished customer,please do not hesitate to contact us!

    Certificates
    • Retatrutide TB500 LL37 GHK-CU BT5 BT10 375  CU50 CU100 CAS154947-66-7 Recombinant peptide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Organic Reagents

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.