 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Mazdutide| TongPeptides | 99% Purity |MDT5MDT10

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10 buy - large image1

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10 buy - image1

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10 buy - image2

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10 buy - image3

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10 buy - image4

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10

Name: Mazdutide| TongPeptides | 99% Purity |MDT5MDT10
Brand: Tongpeptide
SKU: pr2608131357
Price: 10 USD
Availability: InStock

TDS 3 Inquiries

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Sample Available:

Yes

Price valid (until):

2026-09-13

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description
Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

MDT is an advanced research-grade dual-target bioactive peptide optimized for modern metabolic wellness regulation. Developed with a refined molecular structure and enhanced biological stability, this innovative peptide compound features dual-receptor affinity, enabling layered and comprehensive physiological modulation. Compared with single-pathway regulatory ingredients, MDT integrates multiple gentle balancing mechanisms, targeting core metabolic signaling pathways that govern energy utilization, nutritional metabolism, and bodily energy balance. Thanks to its high bioavailability and excellent physiological compatibility, it has become a prominent research subject in exploring sub-health metabolic conditioning and long-term physical wellness maintenance.

The core strength of MDT lies in its mild, synergistic metabolic regulation mode. It gently tunes the body’s natural energy perception and digestive rhythm, helping stabilize daily dietary behavior and reduce unplanned excessive energy intake. Meanwhile, it optimizes hepatic and systemic energy metabolism efficiency, encouraging the natural breakdown and utilization of accumulated excess energy substances. This gradual, non-intrusive adjustment effectively relieves chronic metabolic pressure caused by sedentary lifestyles, irregular meal schedules, and long-term high-energy dietary patterns, improving sub-health conditions related to metabolic inertia and unbalanced energy circulation.

Standardized laboratory observations and wellness research demonstrate that cyclic exposure to MDT supports comprehensive metabolic flexibility and balanced body composition. It assists in stabilizing daily glucose and lipid metabolic levels, reducing visceral metabolic burden, and enhancing the body’s adaptive capacity to modern lifestyle pressures. By improving basic cellular energy conversion and optimizing systemic metabolic rhythm, MDT helps maintain a lean physical state and steady physiological vitality, effectively alleviating long-term sub-health fatigue caused by inefficient metabolism and energy imbalance.

MDT presents a reliable and mild tolerance profile in public research data. Its optimized peptide structure fits seamlessly with human biochemical pathways, resulting in only rare, transient adaptive responses during initial use, which naturally fade after short-term bodily adaptation. No physical dependence or drastic physiological fluctuation has been recorded in standardized trials, making MDT suitable for safe, long-term cyclic wellness conditioning and sustained metabolic balance optimization.

It is strictly clarified that all content is summarized from public academic research and laboratory observational data, for scientific research and wellness reference only. MDT is a professional research-grade bioactive peptide material, not a medical product or daily nutritional supplement. It does not provide therapeutic functions and cannot replace professional medical diagnosis, treatment or guidance. Individuals with underlying health conditions or ongoing physical management plans should consult qualified healthcare practitioners before any exploratory application.

Shipping Method

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items Specifications

MDT5
5mg*10vials

MDT10 10mg*10vials

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Research & Reference Note

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sources

PubChem

ClinicalTrials.gov

FDA Drugs@FDA

NIH
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Polypeptide

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water
Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7	Research Grade/99	$9.1/MT FOB	Xinhong Bio-Chem Co., Ltd.	Inquiry
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale	Reagent Grade/99.9	$70/UNIT FOB	Yixin Biotechnology Co., Ltd.	Inquiry
LL37, Research peptide, Lyophilized powder, Antimicrobial activity, Skin repair, Anti-inflammatory, Host defense peptide, Wound healing	Pharmaceutical Grade/99	$95/UNIT FOB	Beijing Novio Biotechnology Co., Ltd.	Inquiry
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide	Pharmaceutical Grade/99	$10/MT FOB	Jinan Pingxing Trading Co., Ltd.	Inquiry
LL37 375 Factory direct sale 99% purity China warehouse wholesale price 5 mg/vial 10vial/kit	Pharmaceutical Grade/99.9	$35-36/UNIT FOB	STARBEAUTY BIOTECH LIMITED	Inquiry

Mazdutide| TongPeptides | 99% Purity |MDT5MDT10

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller

Items	Specifications
MDT5	*5mg10vials**
MDT10	*10mg10vials**