Product
Supplier
Encyclopedia
Inquiry
2-Oxo-2,3-secofriedelan-3-oic acid buy - large image1
2-Oxo-2,3-secofriedelan-3-oic acid buy - image1

2-Oxo-2,3-secofriedelan-3-oic acid

Unit Price: Get Latest Price
CAS No.:

357952-10-4

Content:

99%

Brand:

CUIKANG

Packaging:

G/bottle,Kg/bag,25kg/barrel

Price valid (until):

2025-01-30

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Cosmetics raw materials,Pesticide intermediate,Photoelectric material,pharmaceutical intermediates,Raw materials for food and health products,Polymer materials

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Urocortin II (UcnII) is a neuropeptide that has a variety of physiological functions, including regulating blood pressure, heart rate, and inflammatory response. In experiments, UcnII has been shown to increase the contractility of ventricular myocytes in mice, through a CRF2 receptor-mediated pathway. In addition, UcnII can also stimulate the production of nitric oxide, which contributes to the protective effect of the cardiovascular system. Therefore, Urocortin II (MOUSE) may be used to investigate the treatment and prevention of cardiovascular diseases, as well as to develop new drug treatment strategies (reference to relevant literature)

    Items Specifications






    Basic Info
    Product Name:

    FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

    CAS No.:

    357952-10-4

    Categories:

    Polypeptide

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Cosmetics raw materials,Pesticide intermediate,Photoelectric material,pharmaceutical intermediates,Raw materials for food and health products,Polymer materials

    Location:

    D307, Zhuque Square Office Building, No. 14, Chang'an North Road, Beilin District, Xi'an City, Shaanxi Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    45

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Certifications:

    ISO,ISO,ISO

    Shaanxi Cuikang Pharmaceutical Technology Co., Ltd., founded in January 2023, is a wholly-owned subsidiary of Shaanxi Cuicheng Bio-pharmaceutical Technology Co., Ltd., and a comprehensive innovative enterprise focusing on the research and development, production, sales, import and export trade, technical services and related resource allocation and integration of products in the field of fine chemistry and biochemistry. The company has built a 2700 square meter R&D center in Hanzhong, Shaanxi Province, and has established in-depth and stable cooperative relations with three factories, which can provide one-stop service for domestic and foreign customers from pilot R&D to industrial scale-up production.

    Cuikang Company is an enterprise integrating natural products, fine chemicals, biological fermentation, innovative material research and development, production, sales and technical services. It can provide global customers with a series of products with different specifications and models, such as proportional plant extracts, content plant extracts, synthetic chemical blocks, synthetic pharmaceutical intermediates, active API molecules, fermented pharmaceutical intermediates and APIs, health food, functional food raw materials, veterinary drug raw materials, pharmaceutical innovative materials, laboratory equipment, pharmaceutical machinery and equipment.

    The company adheres to the market demand-oriented, technical innovation as the starting point, product quality as the core, customer service as the foundation, and the enterprise spirit of "professional integrity", and wholeheartedly provides high-quality products and services for customers at home and abroad.


  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.