Teriparatide acetate hydrate Lithium Good quality high quality best, compliant

1. Name:Teriparatide Acetate, Teriparatida , Teriparatidum

   Cas No: 52232-67-4(net),99294-94-7(acetate)

   Formula: C181H291N55O51S2

   Molecular: 4117.71

   Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

   Purity:98%

   Appearance: white powder

   Source: synthetic

   Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide

   Parathar,Teriparatide Acetate,Teriparatide Aventis Brand

   
   

2. 
3. 

1. 
   

2.   O

   Payment & Delivery  

   

    packaging

   

   Company Profile

   Hangzhou Subi Peptide Technology Co., Ltd，t is a professional peptide high-tech company integrating research and development, production and service. 
   BSA, OVA peptide-coupled modification; Modification of peptide such as acetylation, amination, methylation, biotin labeling, fluorescence, etc. The beauty peptides developed and produced by the company include: Anti-wrinkle and anti-aging, whitening and Anti-Spot, tighten and repairing, soothing and anti-allergic, promoting hair growth, promoting hair turning black, removing eye bags and dark circles, breast enhancement and slimming and etc. 

   The core team of Subi Peptide is composed of senior experts and professors with more than 20 years of experience in the R&D and production of peptides. It has first-class liquid phase synthesis and solid phase synthesis technology, as well as mature and leading separation and purification technology.

   

   

   FAQ 

   Q1: Can I get some samples?
   A: Yes, we can supply the free sample in some peptide, but the shipping cost is paid by your side.
   
   Q2: How do I make an order?
   A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.
   
   Q3: How to start orders or make payments?
   A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
   Transfer) or Paypal.
   
   Q4: How about delivery lead time?
   A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
   
   Q5:Is there a discount?
   A:Different quantity has different discount.
   
   Q6: How do you treat quality complaint?
   A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
   we will send you free goods for replacement or refund your loss. 

   Our Advantages  

   
   

   1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.

   
   2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.

   
   3.Professionalism of service: customer satisfaction is our greatest work.

   
   4. Reliability: We always believe that only good reputation and product quality can make a good company.

   
   5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.

   
   6. Variety of products: We offer more than 200 peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide,Octapeptide,Nonapeptide,Decapeptide,Copper peptide, Oligopeptide and so on.

   
   

Contact Us

Hangzhou Subi Peptide Technology Co., Ltd

Tel: +86-13223230551

Whatspp: +86-13223230551

Telegram: : +86-13223230551

E-Mail: alice@subipeptide.cn