Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - large image1
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - image1
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - image2
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - image3
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - image4
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - image5
Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials buy - image6

Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials

TDS

Unit Price:

$120-130/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

LM

Packaging:

5mg 10mg 15mg per vial; 10vials/box

Price valid (until):

2026-07-20

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Name:Nora

    email: sales1@xtlmh.com

    whatsapp: +86 15175193912

    Description                                                                      

    • LL-37 is the only Cathelicidin antimicrobial peptide found in human body. It is composed of 37 amino acids in the N-terminal of Cathelicidin protein, starting from L-L, so it is named LL-37.

      LL-37 is a major protein in neutrophils and is widely present in neutrophils, bone marrow, cervical and vaginal squamous. The LL-37 precursor consists of a signal peptide, cathelin conserved region, and 37 amino acid residues that, when activated, are cleaved by serine protease 3 and other proteolytic enzymes to produce bioactive LL-37, which has antibacterial, antifungal, and antiviral functions, as well as chemotactic and immunostimulatory/regulatory effects.

    Shop Manufacturer Wholesale CAS 154947-66-7 Ll 37 Antimicrobial Protein Ll-37 Peptide Raw Material Powder 2mg Vial-Detailed Image 1


    • Shop Manufacturer Wholesale CAS 154947-66-7 Ll 37 Antimicrobial Protein Ll-37 Peptide Raw Material Powder 2mg Vial-Detailed Image 2

    • Shop Manufacturer Wholesale CAS 154947-66-7 Ll 37 Antimicrobial Protein Ll-37 Peptide Raw Material Powder 2mg Vial-Detailed Image 3


    • Product Specification:                                                   

    • Product name: ll-37
      Cas number: 154947-66-7
      Purity: >99.0%
      Shelf life: 2 Years
      Appearance: White powder
      Storage: Preserve in tight, light-resistant containers in a cool place


    Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 3 Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 4 Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 5

      Company Profile                                                            

        Changsha Duole Technology Co., Ltd was established in 2020 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures.

        With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.

        Its core team is composed of technical experts in the fields of pharmaceutical engineering, fermentation engineering and protein engineering. The company has built a 3,300-square-meter recombinant drug research and development center in Shibei, Yuelu District, Changsha City. It has a complete pharmaceutical engineering, preparation and quality research system and talent team, and has built a GMP workshop to meet the international market API supply and CDMO services.

        At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 7

    Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 8 Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 9

    Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 10

      Why Choose us                                                             

    Our company has independent factories, mass production of pharmaceutical intermediates, organic intermediates and other raw materials, widely used in medicine, health care products, cosmetics, nutritional supplements, food additives and other fields.

        Our company adheres to the business philosophy of integrity and cooperation. scientific innovation and service first.With absolute quality assurance as the purpose and perfect service system as the basis, our company provides efficient and satisfactory consulting services, sincerely welcomes your business inquiries,and looks forward to working with you to create a new future.  

    Key Products:
    Our primary focus encompasses a range of products, including weight loss peptides, medicinal peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Semaglutide, Tirzepatide, Retatrutide, and others.



    Advantage&Packing                                                       

    Shop Manufacturer direct sales of high quality Sermaglutide CAS 910463-68-2 diabetes treatment-Detailed Image 13

    Shipping                                                                           

    Shop Manufacturer direct sales of high quality Sermaglutide CAS 910463-68-2 diabetes treatment-Detailed Image 14


    FAQ                                                                                   


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods ?
    We could accept pay through paypal,bank transfer, XTransfer and bitcoin.


    Certificates
    • Skincare and Beautyhot Products Ll37 Kpv CAS 154947-66-7 Peptides 10mg/Vials Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Certifications:

    COA

    Company Profile
       Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.