Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - large image1
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - image1
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - image2
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - image3
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - image4
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - image5
LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity buy - image6

LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity

TDS 1 Inquiries

Unit Price:

$88/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangdong

Brand:

CaoQuan

Packaging:

5mg/vial

Price valid (until):

2028-06-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Sales manager:Claire
    whatsapp:+8618330919622
    Email: 18330919622@163.com

    sincerely look forward to your inquiries about our products.



      Product Detail  


    Description:

    • Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

      The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

      we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

      This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!

    • Application:

      1. LL37 has been used as an antimicrobial agent to improve wound healing.

      2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

      3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

      4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

      5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

      6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.


    Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 1

    • Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 2


    Shop LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity-Detailed Image 3

    Shop LL37 high purity and High Quality Factory Direct Sales Peptide 99% Purity-Detailed Image 4




    Items Specifications

    CAS RN

    154947-66-7

    Appearance

    White Powder

    Purity

    99%

    Storage condition

    -20℃


      Company Profile 


    Changsha Caoquan Technology Co., Ltd. is a high-tech company specializing in the research and development and production of polypeptide drugs. The company has an advanced industrial chain, covering the research and development, approval and industrialization of peptide raw materials and preparations. Its products include innovative drugs, raw materials, enzymes used in medicine and green synthesis industry, functional peptides and protein products.
    Our core strengths are advanced polypeptide technology, strict quality control (conforming to cGMP standards), professional R&D team, and end-to-end solutions from raw materials to finished products.
    We are committed to providing customers with high-quality and high-value products and services and have established a good reputation in the global market. With excellent product quality, logistics service and customer-centered business philosophy, our products have been exported to more than 100 countries.
    Changsha Cao Quan is willing to maintain cooperative relations with old and new friends and create a better future together!

    Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 4 Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 5

    Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 6


    Why Choose US   


    • High Purity (≥98%) – Strictly tested, consistent quality.
    •  Flexible Packaging Options – 10mg/vial, bulk available.
    • Trusted by Global Buyers – Stable supply, fast delivery.

    FAQ

      Q1:How to send order?
      A:Send order list to us,we quote best price for you,then ship package out and offer tracking nubmer to you after payment send.

      Q2:Do you have samples for our reference?
    A:Sure,we can offer smaples,the customers will pay the freight.

      Q3:Any discount if order more?
    A:Sure,the price is negotiable,you can get much better price if order big quantity.

     Q4:What about the delivery time?
    A:Ship within 1-2 days after confirming payment (excluding Chinese holidays).5-10 working days to arrive your address.

     Q5:What kind of payment terms do you accept?
    A:Payment can be made by Bank transfer, BTC,Credite Card,TT,Paypal,Alipay,Wechat,Visa,Mastercard,Appple Pay,Goolge Pay.

    Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 7

    Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 8

    Shop cjc 1295 without DAC peptide sample support, high purity, high quality safe shipping and best price-Detailed Image 9




    Our Certificate



    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

    Location:

    Room 102, No. 60-20, Gongnong Street, Xiangya Road Subdistrict, Kaifu District, Changsha City, Hunan Province, China

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.