Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Professional Peptide Care Face Skin Repairing LL37 375
Professional Peptide Care Face Skin Repairing LL37 375 buy - large image1
Professional Peptide Care Face Skin Repairing LL37 375 buy - image1
Professional Peptide Care Face Skin Repairing LL37 375 buy - image2
Professional Peptide Care Face Skin Repairing LL37 375 buy - image3
Professional Peptide Care Face Skin Repairing LL37 375 buy - image4
Professional Peptide Care Face Skin Repairing LL37 375 buy - image5
Professional Peptide Care Face Skin Repairing LL37 375 buy - image6

Professional Peptide Care Face Skin Repairing LL37 375

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

SIHAI

Packaging:

10 mg/vial

Price valid (until):

2026-10-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Description

    ContactInformation:WhatsApp+8613152736103 Email address:saIes02@adsh.top

    If you're interested, please send us an inquiry and let us know how to contact you. We'll respond within 24 hours.

    Send  Quote We'll send you a detailed quote with the total price.
    Select Payment Method Please select your preferred payment method
    After Payment Please provide your shipping address after payment.
    Tracking We will provide the tracking after goods sent.
    Lead time About 1-5 working days after payment
    Shipping time About 8-15 days door to door
    After-sale service Available always


    Shop High Compatibility High Absorption Cost effective Semax XA11-Detailed Image 1 Shop High Compatibility High Absorption Cost effective Semax XA11-Detailed Image 2 Shop High Compatibility High Absorption Cost effective Semax XA11-Detailed Image 3


    1.:We offer various types of peptides,about the peptides,we can provide the good quality,the good price.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.

    Product Name 

      LL37 375

    Purity   99%
    Package   Foil Bag , Abe bottle or other
    Transportation   By Air
    Sample   Availiable


    Shop Instant delivery Support OEM Wholesale Price Snap-8 NP810-Detailed Image 4 Shop Instant delivery Support OEM Wholesale Price Snap-8 NP810-Detailed Image 5 Shop High purity Cost Effective Freeze dried powde Safety Botulinum toxin-Detailed Image 6  

    2:Company advantages

     

    Are you from these countries?United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.

    Good News! We guarantee Mazdutide MDT10smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.

     

    Why Choose Us:

    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.

    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.

    Easy Payment: Pay with Bitcoin,USDT,PAYAPL, or bank transfer.

    Good Quality: Our products are great, and we support small test orders.

     

     

    3:Company Introduction

    Shanxi An Da Si Hai Technology Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.

    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly. Our customers come from countries including the United States, Europe,

    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment. Please let us know the specific quantity you need.

    We are engaged in the development, marketing and sales of intermediates, Peptides, Ste roids, Sterol, chemicals and other products.

    In order to serve customers well, the company has established special technical department and after-sale service department.

    We will make careful reply if you get any question. We will satisfy market demands by top products and better service, and will welcome market challenge

    We will offer you the most competitive price. Feel free to contact us for more information.

    Shop High Compatibility High Absorption Cost effective Semax XA11-Detailed Image 6 Shop Skin Care Skin Repairing Peptide Manufacturers HMG G75-Detailed Image 8 Shop Skin Care Skin Repairing Peptide Manufacturers HMG G75-Detailed Image 9  Shop Exclusive design Budget friendly High demand Mazdutide MDT10-Detailed Image 11



    4:FAQ

     

    Q1:Are you a supplier or a manufacturer?

    A:We are both a supplier and a manufacturer.

     

    Q2:How will you deliver the goods?

    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

     

    Q3:Which kind of payment terms do you accept?

    A:, Bitcoin, PayPal.USDT.

     

    Q4:How is the after-sales service?

    A:We will provide high-quality products and ensure 100% safe deliver.

     

    Q5:how can we guarantee quality?

    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

     

    Q6: How to confirm the Product Quality before placing orders?

    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

     

    Q7:Is there any discount?

    A:Yes, for larger quantity, we always support with better price.

         

    Content Peptides
    Address CHINA
    Brand SIHAI
    Grade Pharmacy Grade
    Sample Availiable

    CAS NO 154947-66-7
    Form Powder
    Package Standard export package
    OEM/ODM Availiable

    Certificates
    • Professional Peptide Care Face Skin Repairing LL37 375 Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Shanxi An Da Si Hai Technology Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.