Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - large image1
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - image1
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - image2
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - image3
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - image4
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - image5
Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers buy - image6

Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

SIHAI

Packaging:

5 mg/vial

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Description

    I am OLivia: My email address is sales01@adsh.top WhatsApp: +8617732934935

    Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.

    1. Superior Product Quality

    Product quality is the foundation of our business. Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

    Each batch includes a Certificate of Analysis (COA) with key data:
    • Purity (HPLC)
    • Molecular weight (MS)
    • Water content
    • Residual solvents
    • Microbial limit (if applicable)

    For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.

    2. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    • Custom peptide synthesis (mg to kg scale)
    • Peptide modifications and labeling
    • Small molecule synthesis
    • Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

    3. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    • Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    • Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    • Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal

    1. Expertise in Peptide Synthesis

    Extensive Experience: 7 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.

    2. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    3. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug.

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.


    Content Peptides
    Address CHINA
    Brand SIHAI
    Grade Pharmacy Grade
    Sample
    Availiable
    Purity 99%
    Form Powder
    Package Standard export package
    OEM/ODM Availiable


    The importance of peptides

    Peptides play a crucial role in the human body and are widely present in various active substances. They are deeply involved in multiple key areas such as human hormone regulation, nerve conduction, and cell growth and reproduction. Their core value lies in regulating the physiological functions of various systems and cells in the body: they can not only activate related enzyme systems and promote the improvement of intermediate metabolic membrane permeability, but also trigger specific physiological effects through pathways such as controlling DNA transcription and influencing the synthesis of specific proteins.

    As key substances involved in various cellular functions of the human body, peptides can not only enter cells to regulate their functional activities after synthesis, but also act as neurotransmitters in the body to undertake the responsibility of information transmission. At the same time, peptides are also efficient "transport carriers" that can accurately deliver nutrients such as vitamins, biotin, calcium and various trace elements to the cells, organs and tissues of the human body. In addition, they are important physiological regulators of the human body, which can comprehensively regulate physiological functions, enhance and exert the body's own physiological activity, and possess irreplaceable biological functions.


    Shop SM02 High-demand sale 910463-68-2 multi specification peptides for weight loss-Detailed Image 2

    Please note the following points when storing peptides:
    - Store peptides in a cool, dry and dark environment
    - Avoid repeated freezing and thawing of peptides
    - Prevent peptides from being overexposed to air
    - Protect peptides from light
    - Do not store peptides in solution for a long time
    - Aliquot peptides according to specific experimental requirements









    Shop SM02 High-demand sale 910463-68-2 multi specification peptides for weight loss-Detailed Image 6


    Shop SM02 High-demand sale 910463-68-2 multi specification peptides for weight loss-Detailed Image 7

    Shop Top selling powder KS5 KissPeptin-10 Premium standard ingredient peptides-Detailed Image 8


                                                    Introduction to Shanxi Anda Sihai Technology Co., Ltd.
    Since its establishment, Shanxi Anda Sihai Technology Co., Ltd. has been committed to the research and development, sales and services of peptides, cosmetic raw materials and plant extracts. We boast a team characterized by innovation and a strong sense of responsibility, dedicated to delivering satisfactory services to customers and fostering their repeat business.

    Presently, our products are exported to numerous countries across the Americas, Europe, Southeast Asia and beyond. We sincerely welcome the opportunity to establish long-term cooperative partnerships with you!

    With extensive experience in raw materials for food, cosmetics and health products, we ensure your procurement is both time and cost efficient through our highly competitive pricing and professional services.

    Leveraging rich lean production experience, we maintain full control over the quality of every product. Additionally, our comprehensive inspection procedures guarantee that you receive premium-quality products.Shop DS5  DSIP Bulk price peptides 5mg powder Expert service raw materials-Detailed Image 5

    Shop FM2 MGF CAS 12020-86-9-Detailed Image 8


    Shop FM2 MGF CAS 12020-86-9-Detailed Image 11



    Shop Weight loss peptides GP 5mg powder CAS 87805-34-3 Stock on hand-Detailed Image 13



    Shop MDT10 Mazdutide CAS 2259884-03-0-Detailed Image 12


    Shop FM2 MGF CAS 12020-86-9-Detailed Image 15



    Shop FM2 MGF CAS 12020-86-9-Detailed Image 16

    Certificates
    • Lyophilized powder peptide product 375 LL37 Peptide specialty manufacturers Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Shanxi An Da Si Hai Technology Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.